KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668405
Entry
104668405         CDS       T03989                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03420  Nucleotide excision repair
rro04115  p53 signaling pathway
rro04120  Ubiquitin mediated proteolysis
rro05161  Hepatitis B
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05222  Small cell lung cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    104668405 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    104668405 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    104668405 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104668405 (DDB2)
   05202 Transcriptional misregulation in cancer
    104668405 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104668405 (DDB2)
   05212 Pancreatic cancer
    104668405 (DDB2)
   05225 Hepatocellular carcinoma
    104668405 (DDB2)
   05226 Gastric cancer
    104668405 (DDB2)
   05214 Glioma
    104668405 (DDB2)
   05216 Thyroid cancer
    104668405 (DDB2)
   05220 Chronic myeloid leukemia
    104668405 (DDB2)
   05217 Basal cell carcinoma
    104668405 (DDB2)
   05218 Melanoma
    104668405 (DDB2)
   05213 Endometrial cancer
    104668405 (DDB2)
   05224 Breast cancer
    104668405 (DDB2)
   05222 Small cell lung cancer
    104668405 (DDB2)
   05223 Non-small cell lung cancer
    104668405 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    104668405 (DDB2)
   05169 Epstein-Barr virus infection
    104668405 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rro04121]
    104668405 (DDB2)
   03400 DNA repair and recombination proteins [BR:rro03400]
    104668405 (DDB2)
Ubiquitin system [BR:rro04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     104668405 (DDB2)
DNA repair and recombination proteins [BR:rro03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      104668405 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 104668405
NCBI-ProteinID: XP_010369398
UniProt: A0A2K6RV49
LinkDB
Position
15
AA seq 427 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPRELEPEAKKLCAKGSGPSRRGDSDCLWAGLAGL
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagaggtgactcagactgcctctgggcggggctggctggccta
cagatcctgccgccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgctccctttgacaggagggctacatccttggcgtggcac
ccgactcaccccagcactgtggctgtgggttccaaagggggagacatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtccgccagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggatggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgccacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgtcgtaggccgatacccagatcctaat
ttcaaaagttgtaccccctatgaattgaggacgatcgatgtgtttgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgctcaatgagttc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacccggaaatga

DBGET integrated database retrieval system