KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668708Help
Entry
104668708         CDS       T03989                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00020  Citrate cycle (TCA cycle)
rro00190  Oxidative phosphorylation
rro01100  Metabolic pathways
rro01200  Carbon metabolism
rro04714  Thermogenesis
rro04932  Non-alcoholic fatty liver disease (NAFLD)
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05016  Huntington disease
Module
rro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104668708 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104668708 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    104668708 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104668708 (SDHA)
   05012 Parkinson disease
    104668708 (SDHA)
   05016 Huntington disease
    104668708 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    104668708 (SDHA)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104668708 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 104668708
NCBI-ProteinID: XP_010369777
LinkDB All DBs
Position
Un
AA seq 538 aa AA seqDB search
MEEDNWRWHFYDTVKGSNWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAF
GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRG
VIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
QFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIRE
GRGCGPEKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGI
PTNYKGQVMMLAPLPQLERRLGQWGPPRSCLFRSLGDKVPPIKPNAGEESVMNLDKLRFA
DGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDL
VETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEHDYSKPIQGQQKKPFEEHW
RKHTLSYVDISTGKFTAREQHITQRKQLCLCDXGLSTRKEWTVGTCSSLNKSESHYAA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacaactggaggtggcatttctacgacaccgtgaagggctccaactggctg
ggggaccaggatgccatccactacatgacagagcaggctcccgccgccgtggttgagctg
gaaaattacggcatgccgttcagcagaactgaagatgggaagatttatcagcgtgcattt
ggtggacagagcctcaaatttggaaagggcgggcaggcccatcggtgctgctgtgtggct
gatcggaccggccactcactattgcacaccttatatggaaggtctctgcgatatgatacc
agctattttgtggagtattttgccttggatctcctgatggagaacggggagtgccgtggt
gtcatcgcactgtgcatagaggacgggtccatccatcgcataagagcaaagaacactgtt
gttgccacaggaggctacgggcgcacctacttcagctgcacgtctgcccacaccagcacc
ggcgacggcacggccatgatcaccagggcaggccttccctgccaggacctagagtttgtt
cagttccaccccacaggcatatatggtgctggttgtctcattacggaaggatgtcgtgga
gagggaggcattctcattaacagtcaaggcgaaaggtttatggagcgatacgcccccgtg
gcgaaggacctggcgtctagagacgtggtgtctcggtcgatgactctggagatccgcgaa
ggaagaggctgtggccctgagaaagatcacgtctacctgcagctgcaccacctgcctcca
gagcagctggccacgcgcctgcccggcatttcagagaccgccatgatcttcgctggtgtg
gacgtcacgaaggagccgatccctgtcctccccaccgtgcattataacatgggcggcatt
cccaccaactacaaggggcaggtgatgatgctggctcccctcccacagctggaaagaagg
ctgggacaatggggcccacctcgcagttgtctctttagatcgttaggagataaagtccct
ccaattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattgagatttgct
gacggaagcataagaacatcagaacttcgactcagcatgcagaagtcaatgcaaaatcat
gctgctgtgttccgtgtgggaagcgtgttgcaagaaggttgtgggaaaatcagcaagctc
tatggagacctgaagcacctgaagacgtttgaccggggaatggtctggaacacggacctg
gtggagactctggagctgcagaacctgatgctgtgtgcgctgcagaccatctacggagca
gaggcgcggaaggagtcacggggtgcacacgccagggaagactacaaggtgcggattgat
gagcacgattactccaagcccatccaggggcaacagaagaagccctttgaggagcactgg
aggaagcacaccctgtcctatgtggacatcagcactgggaagtttacagccagagagcaa
cacatcacgcagaggaaacagttgtgcttatgtgatnggggcctcagcactaggaaggag
tggactgttggcacatgcagcagcttgaataaatctgaaagtcactatgctgcataa

DBGET integrated database retrieval system