KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668708
Entry
104668708         CDS       T03989                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00020  Citrate cycle (TCA cycle)
rro00190  Oxidative phosphorylation
rro01100  Metabolic pathways
rro01200  Carbon metabolism
rro04714  Thermogenesis
rro04932  Non-alcoholic fatty liver disease
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05014  Amyotrophic lateral sclerosis
rro05016  Huntington disease
Module
rro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104668708 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104668708 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    104668708 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104668708 (SDHA)
   05012 Parkinson disease
    104668708 (SDHA)
   05014 Amyotrophic lateral sclerosis
    104668708 (SDHA)
   05016 Huntington disease
    104668708 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    104668708 (SDHA)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104668708 (SDHA)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Other DBs
NCBI-GeneID: 104668708
NCBI-ProteinID: XP_030782940
LinkDB
Position
3
AA seq 664 aa
MSGVRRLSRLLSTRRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVSTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgtcgggggtccggaggctgtcgcggctgctgagcactcggcgcctggcgctggccaag
gcgtggccaacagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttacaaagctgtttcctaccaggtcacacact
gttgcagcgcagggaggaatcaacgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacagagcaggctcccgccgccgtggttgagctggaaaattacggcatgccgttc
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaaattt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggaccggccactcacta
ttgcacaccttatatggaaggtctctgcgatatgataccagctattttgtggagtatttt
gccttggatctcctgatggagaacggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccatccatcgcataagagcaaagaacactgttgttgccacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcaccggcgacggcacggccatgatc
accagggcaggccttccctgccaggacctagagtttgttcagttccaccccacaggcata
tatggtgctggttgtctcattacggaaggatgtcgtggagagggaggcattctcattaac
agtcaaggcgaaaggtttatggagcgatacgcccccgtggcgaaggacctggcgtctaga
gacgtggtgtctcggtcgatgactctggagatccgcgaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctgcctccagagcagctggccacgcgcctg
cccggcatttcagagaccgccatgatcttcgctggtgtggacgtcacgaaggagccgatc
cctgtcctccccaccgtgcattataacatgggcggcattcccaccaactacaaggggcag
gtcctgaggcacgtgaatggccaggatcagattgtgcccgggctgtacgcctgtggggag
gccgcctgtgcctcggtacatggtgccaaccggctcggggcaaactccctcttggacctg
gttgtctttggtcgggcatgtgccctgagcatcgaagagtcatgcaggcctggagataaa
gtccctccaattaaaccaaatgctggggaagaatctgtcatgaatcttgacaaattgaga
tttgctgacggaagcataagaacatcagaacttcgactcagcatgcagaagtcaatgcaa
aatcatgctgctgtgttccgtgtgggaagcgtgttgcaagaaggttgtgggaaaatcagc
aagctctatggagacctgaagcacctgaagacgtttgaccggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcgcggaaggagtcacggggtgcacacgccagggaagactacaaggtgcgg
attgatgagtacgattactccaagcccatccaggggcaacagaagaagccctttgaggag
cactggaggaagcacaccctgtcctatgtggatgtcagcactgggaaggtcactctggaa
tatagacccgtaatcgacaaaactttgaacgaggctgactgtgccaccgttcccccagcc
attcgctcctactga

DBGET integrated database retrieval system