KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104668984
Entry
104668984         CDS       T03989                                 

Gene name
NKX6-3
Definition
(RefSeq) homeobox protein Nkx-6.3
  KO
K09351  homeobox protein Nkx-6.3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104668984 (NKX6-3)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104668984 (NKX6-3)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 104668984
NCBI-ProteinID: XP_010370106
UniProt: A0A2K6NSQ1
LinkDB
Position
9
AA seq 263 aa
MESNLQGTFLLNNTPLAQFPEMKAPVCQYSVQNSFYKLSSPGLGPQLAAGTPHGITDILS
RPVAAPNSSLLSGYSHVAGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTGQDWR
GSRQCSNTPDPLSESIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTE
SQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGASAGGDRAPSENEDDEYNKPLDPDSDDE
KIRLLLRKHRAAFSVLSLGAHSV
NT seq 792 nt   +upstreamnt  +downstreamnt
atggagtccaacctgcaggggacgttcctgctgaacaacacgccgctggctcagtttccg
gagatgaaggcccctgtgtgccagtactcagtgcagaactccttctacaagctcagctcc
ccggggctgggcccccagctggccgcggggaccccccacgggatcacggacatcctgagc
aggcccgtggctgcaccgaacagcagcctcctctccggctactcccacgtggcaggcttc
ggggggctcagctcgcagggggtgtactacagcccccaggtaggaaatttttccaaggct
gggaacgagtaccccacccggacccggaactgctgggcggacacgggccaggactggcga
ggcagtcggcagtgcagcaacaccccagatcccctgagtgagagcatacacaagaagaag
cacacccggcccaccttcacggggcaccagatctttgccctggagaaaacctttgagcag
accaagtacttggctggccctgagagggcgcggctggcatactccctgggcatgactgaa
tcgcaggtcaaggtgtggttccagaaccgcaggaccaagtggcgaaagaagagcgccctg
gaaccctcgtcctccacgccccgggccccgggcggcgcaagcgcaggcggggaccgcgca
ccctcggagaacgaggacgacgagtacaacaagccgctggaccctgactcggacgacgag
aagatccgcctgctgctgcgcaagcaccgcgccgccttctcggtgctcagcctgggagcg
cacagcgtctga

DBGET integrated database retrieval system