KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669170
Entry
104669170         CDS       T03989                                 

Gene name
PTGER2
Definition
(RefSeq) prostaglandin E2 receptor EP2 subtype
  KO
K04259  prostaglandin E receptor 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04750  Inflammatory mediator regulation of TRP channels
rro04924  Renin secretion
rro05163  Human cytomegalovirus infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104669170 (PTGER2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104669170 (PTGER2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104669170 (PTGER2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104669170 (PTGER2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669170 (PTGER2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104669170 (PTGER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104669170 (PTGER2)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    104669170 (PTGER2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Srg
Other DBs
NCBI-GeneID: 104669170
NCBI-ProteinID: XP_010370378
UniProt: A0A2K6NIX1
LinkDB
Position
5
AA seq 358 aa
MGNASNDSRPEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDAGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPAIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVAVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLSLMRSVLCCRISLRTQDTIQTSCSTQSDASKQADL
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgggcaatgcctccaatgactcccggcctgaggactgcgagacgcgacagtggcttccc
ccaggcgaaagcccagccatcagctccgtgatgttctcggccggggtgctggggaacctc
atagcactggcgctgctggcgcgccgctggcggggggacgcggggtgcagcgccggccgc
aggagctccctctccttgttccacgtgctggtgacggagctggtgttcaccgacctgctc
gggacctgcctcatcagcccggtggtactagcttcttacgcgcggaaccagaccctggtg
gcactggcgcccgagagccgcgcgtgcacctacttcgctttcgccatgaccttcttcagc
ctggccacgatgctcatgctcttcgccatggccctggagcgctacctctcgatcgggcac
ccctacttctaccagcgccgcgtctcgcgctccgggggcctggccgtgctgcccgccatc
tatgccgtctccctgctcttctgctcactgccgctgctggactacgggcagtacgtccag
tactgccccggaacctggtgcttcatccggcacgggcggaccgcttacctgcagctgtac
gccaccctgctgctgcttctcatcgtcgcggtgctcgcctgcaacttcagtgtcattctc
aacctcatccgcatgcaccgccgaagtcggagaagccgctgtggaccttccttgggcagt
ggccggggcggccccggggcccgcaggagaggggaaagggtgtccatggcggaggagacg
gaccacctcattctcctggctattatgaccatcaccttcgccgtctgctccttgcctttc
acgatttttgcatatatgaatgaaacctcttccagaaaggaaaagtgggacctccaagct
cttaggtttttatcaattaattcaataattgacccttgggtctttgccatccttaggcct
cctgttctgagcctaatgcgttcagtcctctgttgtcggatttcattaagaacacaagat
acgatacaaacttcctgttctacacagtcagatgccagtaaacaggctgacctttga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676931
Entry
104676931         CDS       T03989                                 

Gene name
PTGER4
Definition
(RefSeq) prostaglandin E2 receptor EP4 subtype isoform X1
  KO
K04261  prostaglandin E receptor 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
rro04750  Inflammatory mediator regulation of TRP channels
rro04924  Renin secretion
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104676931 (PTGER4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104676931 (PTGER4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104676931 (PTGER4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676931 (PTGER4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    104676931 (PTGER4)
   05165 Human papillomavirus infection
    104676931 (PTGER4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104676931 (PTGER4)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    104676931 (PTGER4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL
Other DBs
NCBI-GeneID: 104676931
NCBI-ProteinID: XP_010380105
UniProt: A0A2K6PV71
LinkDB
Position
3
AA seq 490 aa
MSTPGVNASTSLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAATAVTPVAS
RGHPAASPGLPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLY
QPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRER
SGQHCSDSRRTSSAMSGHSRSFLSRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGV
PGMGLTQKDTTSLRTLRISETSDSSQGQDSESVLLVDEVGESGRAGPAPKGSSLQVTFPS
ETLNLSEKCI
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtccactcccggggtcaatgcgtccacctccttgagccccgaccggctgaacagcccg
gtgaccatcccggcggtgatgttcatcttcggggtggtgggcaacctggtggccatcgtg
gtgctgtgcaagtcgcgcaaggagcaaaaggagacgaccttctacacgctggtatgtggg
ctggctgtcaccgacctgttgggcactttgctggtgagcccggtaaccatcgccacgtat
atgaagggccagtggcccgggggccagccgctgtgcgagtacagcaccttcattctgctc
ttcttcagcctgtccggcctcagcatcatctgcgccatgagtgtagagcgctacctggcc
atcaaccacgcctatttctacagccactacgtggacaagcggttggcgggcctcacactc
tttgcagtctatgcttccaacgtgctcttctgcgcgctgcccaacatgggcctcggtagc
tcgcggctgcagtacccagacacctggtgcttcatcgactggaccaccaacgtgacggcg
cacgctgcctactcctacatgtacgcgggcttcagctccttcctcattctcgccaccgtc
ctctgcaacgtgcttgtgtgcggcgcgctgctccgcatgcaccgccagttcatgcgccgc
acctcgctgggcaccgagcagcaccatgcggccgcgaccgctgtgaccccggttgcctcc
cggggccaccccgccgcctccccaggcttgccgcgcctcagcgactttcgccgccgccgg
agtttccgccgcatcgcgggcgccgagatccagatggtcatcttactcattgccacctcc
ctggtggtgctcatctgctccatcccgctcgtggtgcgagtattcgtcaaccagttatat
cagccaagtttggagcgagaagtcagtaaaaatccagatttgcaggccatccgaattgct
tctgtgaacccgatcctagacccctggatatatatcctcctgagaaagacagtgctcagt
aaagcaatagagaagatcaaatgcctcttctgtcgcattggcggatcccgcagagagcgc
tccggacagcactgctcagacagtcgcaggacatcttctgccatgtcaggccactctcgc
tccttcctctcccgggagctgaaggagatcagcagtacatctcagaccctcctgccagac
ctctcactgccagacctcagtgaaaatggccttggaggcaggaatttgcttccaggtgtt
cctggcatgggcctgacccagaaagacaccacctcgctgaggactttgcgaatatcagag
acctcagactcttcacagggtcaggactcagagagtgtcttactggtggatgaggttggt
gagagcggcagggctgggcctgcccctaaggggagctccctgcaagtcacatttcccagt
gaaacactgaacttatcagaaaaatgtatataa

DBGET integrated database retrieval system