KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669171
Entry
104669171         CDS       T03989                                 

Gene name
PTGDR
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104669171 (PTGDR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104669171 (PTGDR)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    104669171 (PTGDR)
SSDB
Motif
Pfam: 7tm_1 PhoR ResB DUF2892
Other DBs
NCBI-GeneID: 104669171
NCBI-ProteinID: XP_010370379
UniProt: A0A2K6Q8N3
LinkDB
Position
5
AA seq 359 aa
MRSPFYRCQNTTSVEKGNSAMMGAVLFSTGLLGNLLALGLLARSGLGWCSPRPLRPPPSV
FYVLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRRGALVAPVVSAFCLAFCALPFMGFGKLVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRQRRSCT
RDLAEARVDGREASPQHLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDIKEKIRTS
EEAEDLRALRFLSVISIVDPWIFIIFRTPVFRVFFHKIFIRPLTYRNWCSSSTNMESSL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgagatcacccttctaccgctgccagaacaccacctcggtggaaaagggcaactcggcg
atgatgggcgcggtgctcttcagcaccggcctcttgggcaacctgctggccctggggctg
ctggcgcgctcggggctggggtggtgctccccgcgtccactgcgcccgccgccctcggtc
ttctacgtgctggtgtgtggcctgacggtcaccgacttgctgggcaagtgcctcctaagc
cccgtggtgctggctgcctacgctcagaaccggagtctgcgggtgcttgcgcccgcattg
gacaactcgctgtgccaagcattcgccttcttcatgtccttctttgggctctcctcgaca
ctgcaactcctggccatggcactggagtgctggctctccctagggcaccccttcttctac
cgacggcacatcacccttcgccggggcgcactggtggccccggtggtgagcgccttctgc
ctggctttctgtgcgctacctttcatgggcttcgggaagttagtgcagtactgccccggc
acctggtgctttatccagatggtccacgaggagggctcgctgtcggtgctggggtactct
gtgctctactccagcctcatggcgctgctggtccttgccaccgtgctgtgcaacctcggc
gccatgcgcaacctctacgcgatgcaccggcggctgcagcggcagcggcgctcctgcacc
agggaccttgccgaggcgcgtgtggacgggagggaagcgtccccgcagcacctggaggag
ctggatcaccttctgctgctggcactgatgaccgtgctcttcactatgtgttctctgccc
gtaatttatcgcgcttactatggagcatttaaggatatcaaggagaaaatcaggacctct
gaagaagcagaagacctccgagccttgagatttctatctgtgatttcaattgtggaccct
tggatttttatcattttcagaactccagtatttcgagtattttttcacaagattttcata
agacctcttacgtacaggaactggtgcagcagttccactaacatggaatccagtctgtga

DBGET integrated database retrieval system