KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669185
Entry
104669185         CDS       T03989                                 

Gene name
P2RY1
Definition
(RefSeq) P2Y purinoceptor 1
  KO
K04270  P2Y purinoceptor 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04611  Platelet activation
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104669185 (P2RY1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104669185 (P2RY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104669185 (P2RY1)
  09157 Sensory system
   04742 Taste transduction
    104669185 (P2RY1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104669185 (P2RY1)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    104669185 (P2RY1)
SSDB
Motif
Pfam: 7tm_1 DUF4014 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 104669185
NCBI-ProteinID: XP_010370384
UniProt: A0A2K6QII0
LinkDB
Position
1
AA seq 373 aa
MTEVLWPTVPNGTDAAFLAGPGLSWGNSTVASTAAVSASFKCALTKTGFQFYYLPAVYIL
VFIIGFLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG
DAMCKLQRFIFHVNLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAVYISVLVWLIVV
VAISPILFYSGTGVRKNKTTTCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLI
VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFND
RVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLN
ILPEFKQNGDTSL
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaccgaggtgctgtggccgactgtccccaacgggacggacgctgccttcctggccggt
ccgggtttgtcctgggggaacagcacggtcgcctccactgccgccgtctccgcgtcgttc
aaatgcgccttgaccaagacgggcttccagttttactacctgccggctgtctacatcttg
gtgttcatcatcggcttcctgggcaacagcgtggccatctggatgttcgtcttccacatg
aagccctggagcggcatctccgtgtacatgttcaacttggctctggccgacttcttgtac
gtgctgactctgccagccctgatcttctactacttcaataaaacagactggatcttcggg
gatgccatgtgtaaactgcagaggttcatctttcatgtgaacctctatggcagcatcttg
tttctgacatgcatcagtgctcaccggtacagcggtgtggtgtaccccctcaagtccctg
ggccggctcaaaaagaagaacgcggtctatatcagcgtgctggtgtggctcattgtggtg
gtggcgatctcccccatcctcttctactcaggtaccggggtccgcaaaaacaaaaccacc
acctgttatgacaccacctcagacgagtacctgcgaagttatttcatctacagcatgtgc
acgaccgtggccatgttctgtgtcccgttggtgctgattctgggctgttacggattaatt
gtgagagctttgatttacaaagatctggacaactctcccctgaggagaaaatcgatttac
ctggtgatcattgtactgactgtttttgctgtgtcttacatccctttccatgtgatgaaa
acgatgaatttgagagcccggcttgactttcagaccccagcaatgtgtgctttcaatgac
agggtttatgccacatatcaggtgacaagaggtctagcaagtctcaacagttgtgtggac
cctattctctatttcttggcaggagatactttcagaaggagactctcccgagccacaagg
aaagcttctagaagaagtgaggcaaatttgcaatccaaaagtgaagacatgaccctcaat
attttacctgagttcaagcagaatggagatacaagcttgtga

DBGET integrated database retrieval system