KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669321
Entry
104669321         CDS       T03989                                 

Gene name
ASIC2
Definition
(RefSeq) LOW QUALITY PROTEIN: acid-sensing ion channel 2
  KO
K04828  acid-sensing ion channel 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104669321 (ASIC2)
   04750 Inflammatory mediator regulation of TRP channels
    104669321 (ASIC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104669321 (ASIC2)
Ion channels [BR:rro04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   104669321 (ASIC2)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 104669321
NCBI-ProteinID: XP_030780110
LinkDB
Position
19
AA seq 563 aa
MSRSGGAGLPAAALTGPGRFRMAREEPAPAAVAAAGQPGGGRGGKRALQEPGVARRGRPS
LSRAKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTSLGLLLSWSSNRLLYWLSFPSHTRV
HREWSRQLPFPAVTVCNNNPLRFPRLSKGDLYYAGHWLGLLLPNRTARPLVSELLRGDEP
RRQWFRKLADFRLFLPPRHFEGISAAFMDRLGHQLEDMLLSCKYRGELCGPHNFSSVFTK
YGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTFEAGVKVQIH
SQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFPVYSITACRI
DCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLCRTPCNLTRY
NKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQKKAYEVAALL
GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVSTCDTMPNHS
ETISHTVNVPLQTALGTLEEIAC
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgagccggagcggcggagccgggctgcccgcggccgcgctcaccggcccgggacgcttc
cgcatggcccgcgaggagccggcgcccgcggcggtggcggcggccgggcagcccgggggc
ggcagaggcggcaagcgggcactgcaggagccaggggtcgcccgcagggggcggccgtcg
ctgagccgcgctaaactgcacgggctgcggcacatgtgtgccgggcgcacagcggcgggg
ggctccttccagcggcgggcgctgtgggtgctggctttctgtacatccctcggcttgctg
ctgtcctggtcctcgaaccgtttgctctactggctcagcttcccgtcgcacacgcgggtg
caccgcgagtggagccgccagttacccttccccgccgtcaccgtgtgcaacaacaacccg
ctgcgcttcccgcgcctctccaagggggacctctactatgccggccactggctcgggctg
ctgctgcccaaccgcaccgcgcgcccgctcgtcagcgagctgctgcgcggcgacgagccg
cgccgccagtggttccgaaagctggctgacttccgcctcttcttgccgccgcgccacttc
gagggcatcagcgccgccttcatggaccgcctgggccaccagctcgaggacatgctgctc
tcctgcaagtaccgcggcgagctctgcggcccacacaacttctcctccgtgtttacaaaa
tatgggaagtgttacatgtttaactcaggcgaggatggcaaacctctgctcaccacggtc
aagggggggacaggcaacgggctggagatcatgctggacattcagcaggatgagtacctg
cccatctggggagagacagaggaaacgacatttgaagcaggagtgaaagttcagatccac
agtcagtctgagccacctttcatccaagagctgggctttggggtggctccagggttccag
acctttgtggccacacaggagcagaggctcacatacctgcccccaccgtggggtgagtgc
cgatcctcagagatgggcctcgacttttttcctgtttacagtatcaccgcctgtaggatt
gactgtgagacccgctacatcgtggaaaattgcaactgccgcatggttcacatgccaggg
gatgcccctttctgtacccctgagcagcacaaggagtgtgcagagcctgccctaggtctg
ctggcggaaaaggacagcaattactgtctctgcaggacaccctgcaacctgacccgctac
aacaaagagctctccatggtgaagatccccagcaagacatcagccaagtaccttgagaag
aaatttaacaaatcagaaaaatatatctcagagaacatccttgttctggatatatttttt
gaagctctcaattatgagacaattgaacagaagaaggcgtatgaagttgctgccttactt
ggtgatattggtggtcagatgggattgttcattggtgctagtatccttacaattctagag
ctctttgattatatttatgagctgatcaaagagaagctattagacctgcttggcaaagag
gaggacgaagggagccacgatgagaatgtgagtacttgtgacacaatgccaaaccactct
gaaaccatcagccacactgtgaacgtgcccctgcagacggccctggggaccttggaggag
attgcctgctga

DBGET integrated database retrieval system