KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669357
Entry
104669357         CDS       T03989                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00220  Arginine biosynthesis
rro00330  Arginine and proline metabolism
rro01100  Metabolic pathways
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04146  Peroxisome
rro04371  Apelin signaling pathway
rro04926  Relaxin signaling pathway
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05022  Pathways of neurodegeneration - multiple diseases
rro05133  Pertussis
rro05140  Leishmaniasis
rro05142  Chagas disease
rro05145  Toxoplasmosis
rro05146  Amoebiasis
rro05152  Tuberculosis
rro05200  Pathways in cancer
rro05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    104669357 (NOS2)
   00330 Arginine and proline metabolism
    104669357 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104669357 (NOS2)
   04066 HIF-1 signaling pathway
    104669357 (NOS2)
   04020 Calcium signaling pathway
    104669357 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104669357 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    104669357 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669357 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    104669357 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104669357 (NOS2)
   05014 Amyotrophic lateral sclerosis
    104669357 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    104669357 (NOS2)
   05152 Tuberculosis
    104669357 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    104669357 (NOS2)
   05145 Toxoplasmosis
    104669357 (NOS2)
   05140 Leishmaniasis
    104669357 (NOS2)
   05142 Chagas disease
    104669357 (NOS2)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     104669357 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 104669357
NCBI-ProteinID: XP_010370603
UniProt: A0A2K6NEP5
LinkDB
Position
19
AA seq 1153 aa
MACPWKFLFKTKFHQYVTTGEKDINNNMEKAPCATSSPVTQDDLQYHSLSKQQNESLQPL
VGTGKKSPESLVKPDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARNCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGHDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYSLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPRFCAFARDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKRYTSSVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGICPGNQ
PALVQGILERVVDSPAPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEVTERQRLEALCQRSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTQDGQGPLHHGVCSTWLNSLKPRDQVPCF
IRNASGFHLPEDPSHPCILVGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILQQQLASEVLRVLHEEPGHLY
VCGDVRMAWDVAHTLKQLVAAKLNLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDG
AAVQPRSLEMSAL
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgtaacgactggg
gaaaaagatattaacaacaacatggagaaagccccctgtgccacctccagtccagtgaca
caggatgaccttcagtatcacagcctcagcaagcagcagaatgagtccctgcagcccctc
gtggggacaggaaagaagtctccagaatctctggtcaagccggatgcaaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaggacacactt
caccacaaggccaaagggattttgacttgcaggtccaaatcttgcttgggatccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgctaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtctttgatgcccgcaactgttccaccgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgatggtaagcacgacttccgggtgtgg
aatgctcagctcatccgctacgcgggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtatggc
cgcttcgatgtggtccccctggtcctacaggctgacggccatgaccccgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaaatatgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgctcgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctcgctctggaaagaccgggctgttgttgagatcaacatt
gctgtgctccatagtttccagaagcaaaacgtgaccatcatggaccaccactcagctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcactcctgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaagagagattccattgaaagtcttggtcaaa
gctgtgctcttcgcctgtatgctgatgcgcaagacgatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgccttcaaccccaaggttgtctgcatggataagtacagcctgagctgcctg
gaggaggagcggctgctgttggtggtgaccagtacgtttggcaatggagactgccccggc
aacggagagaaactgaagaaatcgctcttcatgctgaaagagctcaccaacaaattcagg
tatgctgtgtttggccttggctccagcatgtaccctcggttctgcgcctttgctcgtgac
atcgatcagaagctgtcccacctgggggcctctcagctcacccccatgggagaaggggat
gagctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagcgctacacctcc
agtgtgacctgggacccacaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagaacgtgttcaccatgaggctcaaatctcgg
cagaacctacagagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gacggccaaggcctgaactacttgccaggggagcaccttgggatttgcccaggcaaccag
ccggccctggtccaaggcatcctggagcgagtggtggacagccccgcgccccaccagaca
gtgcgcctggaggccctggacgagagcggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggatatcaccacccccccaacccag
ctgctgctccaaaagctggcccaggtggccacagaagtgactgagagacagaggctggag
gccctgtgccagcgctcagagtacagcaagtggaagttcaccaacagccccacattcctg
gaggtgctggaggagttcccatccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggag
atccacctgactgtggccgtggtcacgtaccacacccaagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacagcctgaagccccgagaccaagtgccctgcttt
atacgaaatgccagcggcttccacctccccgaggacccctcccatccttgcatcctcgtc
gggcctggcacaggcatcgccccattccgcagtttctggcagcagcggctccatgactcc
cagcacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattctcgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cagcagcagctggccagcgaggtgctccgtgtgctccatgaggagccaggtcacctctat
gtttgtggggatgtgcgcatggcctgggatgtggcccacaccctgaagcagctggtggct
gccaagctgaacttgaatgaggagcaggtcgaggactatttctttcagctcaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggcgaagaaggacggg
gcggcagtgcaacccaggagcctggagatgtcagccctctga

DBGET integrated database retrieval system