KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669638
Entry
104669638         CDS       T03989                                 

Gene name
ENTPD2
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 2 isoform X2
  KO
K01509  adenosinetriphosphatase [EC:3.6.1.-]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00230  Purine metabolism
rro01100  Metabolic pathways
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104669638 (ENTPD2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104669638 (ENTPD2)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     104669638 (ENTPD2)
SSDB
Motif
Pfam: GDA1_CD39
Other DBs
NCBI-GeneID: 104669638
NCBI-ProteinID: XP_010370976
UniProt: A0A2K6QYH7
LinkDB
Position
16
AA seq 459 aa
MCTYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVSGGGISSYADNPSGAGQSL
VGCLDQALQDVPKERHASTPLYLGATAGMRLLNLTNPEASTSVLTAVTHTLTQYPFDFRG
ARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSP
AEDRASEVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHSFHPCWPRGFSTHVLL
GDVYQSPCTMAQRPQTFNSSASVSLSGSSDPHLCQDLVSGLFSFSSCPFSRCSFNGVFQP
PVAGNFIAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQPAQLA
DYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLR
KGTNFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgtgcacttacggcattgttctggacgctggctcttcacacacgtccatgtttatctac
aagtggccggcagacaaggagaacgacacaggcattgtgggccagcacagctcctgtgat
gtttcaggcgggggcatctccagctatgcagacaacccttctggggccggccagagtctt
gttgggtgccttgatcaggcgcttcaggatgtgcccaaagagagacatgcgagcacgccc
ctctacctgggagccacagcgggtatgcgcctgctcaacctgaccaatccagaggcctca
accagtgtgctcacggcagtgacgcacacactgacccagtacccctttgacttccggggt
gcacgcatcctctcgggccaggaagagggggtgtttggctgggtgactgccaactacctg
ctggagaacttcatcaagtacggctgggtgggccggtggttccggccacggaaggggacg
ctgggggccatggacctgggaggtgcctccacccagatcacctttgagacgaccagtcca
gctgaggacagagccagtgaggtccacctgcgtctctacggccagcactaccgagtctac
acccacagcttcctctgctacggccgtgaccaggtcctccagaggctgctggccagtgcc
ctccagacccacagcttccacccctgctggccaaggggcttttccacccacgtgctgctt
ggggatgtgtaccagtcaccgtgcaccatggcccagcggccccagaccttcaacagcagc
gcgagtgtcagcctgtcaggaagcagtgacccccacctctgccaagatctggtttctgga
ctcttcagcttctcctcctgccccttctcccgatgctctttcaatggggtcttccagccc
ccagtggctgggaactttatcgccttctctgccttcttctacacggtagacttcttgcgg
acttcaatggggttgcccgtggccaccctacagcagctggaggcagccgcagtgaacgtc
tgcaaccagacctgggctcagctgcaagctcgggtgccgggacaaccggcccagctggcc
gactactgcgctggggccatgttcgtgcaacagctgctgagtcgcggctacggcttcgac
gagcgcgccttcggtggcgtgatcttccagaagaaggccgcggatactgcagtgggctgg
gcgctcggctacatgctgaacctgaccaacctgatccccgccgacccgccggggctgcgc
aagggcaccaacttcagctcctgggtcgtcctcctgctgctcttcgcctccgcgctcctg
gctgcccttgtcctgctgctgcgtcaggtgcactctgccaagctgccaagcaccatttag

DBGET integrated database retrieval system