KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669737
Entry
104669737         CDS       T03989                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X2
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04072  Phospholipase D signaling pathway
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104669737 (RALGDS)
   04015 Rap1 signaling pathway
    104669737 (RALGDS)
   04072 Phospholipase D signaling pathway
    104669737 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669737 (RALGDS)
   05231 Choline metabolism in cancer
    104669737 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104669737 (RALGDS)
   05212 Pancreatic cancer
    104669737 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 104669737
NCBI-ProteinID: XP_010371111
LinkDB
Position
16
AA seq 914 aa
MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRP
ESSTQEIGEELINGVIYSISLRKVQLHHGANKGQRWLGYENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCVL
PYSDEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEHSEPIEAEPEALSPVPAVKPTPELELALTPARAPSPLPVPAPAPTPASGSE
LEVAPPPAPKLQQAPEPAVELEPAPAPAPELEPAPVPPPEQDPAPSQTLELEPAPVPVPS
LEPSWPSPVVAENGLSEEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDK
KGKEHLAPTIRATVTQFNSVANCVITTCLGDRSTKAPDRARVVEHWIEVARECRILKNFS
SLYAILSALQSNSIHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKF
ATLEMNPKRAQKRPKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFE
VIAQIKLLQSACNNYSITPDEQFGVWFRAVERLSETESYNLSCELEPPSESASNTLRTKK
NTAIVKRWSDRQAPSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVE
EINISFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVS
GLCNSSSALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEE
DEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRTFTKGVKVKHGASSTLP
RMKQKGLKIAKGIF
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggcggcagggcctgctggcggcgccgagccgctgttt
ccgggctcccggcggagccgcagcgtgtgggacgccgtgcgcctggaggtgggcgtcccc
gacagctgcccggtggtgctgcacagcttcacgcagctcgaccccgacctgccgcgcccg
gagagctccacgcaggagatcggtgaggagctgatcaacggagtcatctactccatctcc
ctgcgcaaggtgcagctgcaccacggagccaacaagggccagcgctggctcgggtatgag
aatgagtcggccctgaacctttatgagacttgcaaggtgcggaccgtgaaggctggcacg
ctggagaagctggtggagcacctggtgcccgccttccagggcagcgacctctcctacgtc
accatcttcctgtgtacctacagagccttcaccaccacccaacaggtcctggacctgctg
tttaaaaggtacggtagatgtgacgccctcacggcctcctctagatacggctgcgtcctt
ccctattccgacgaggatggcggaccccaggaccaacttaaaaatgccatctcctccatc
ctgggcacctggctggaccagtactcggaggatttctgtcaacccccggactttccctgc
ctcaagcagctggtggcctacgtgcaactcaacatgccaggctcagacctggagcgccgt
gcccaccttctcctggcccagctggagcactcggaacccattgaggcagagcctgaggct
ctgtcaccagtgccagctgtaaaaccaactccagagctagagctagctctaacaccagct
cgagcacccagcccactgccagtgccagccccagctccaacaccagcttcaggttcagag
ctagaggttgctccaccgccagctccgaagctccagcaggctccagagccagctgtggaa
ctagaaccagctccagcgccagctccagaactagagccagctccagtaccacctccagaa
caggatccagctccctcccaaactctagagctggagccagctccagtgccagtgccatca
ttagagccttcctggccttcacctgtggttgcagaaaacgggctgagtgaggagaagcct
cacctcttggtgttccctcccgacttggtagcagagcagtttacactgatggatgcggag
ctgttcaagaaggtggtgccctaccactgcctgggctctatctggtcgcagcgggacaag
aagggcaaggagcacctggcacccaccatccgcgccactgtcacccagttcaacagcgtg
gccaactgcgtcatcaccacctgcctcggggaccgaagcacaaaagccccagaccgggcc
agggtggtggagcactggatcgaggtggccagggagtgccggatcctcaagaacttctcg
tcactgtatgccatcctctctgccctgcagagcaactccatccaccggctgaagaagacg
tgggaagacgtttccagggacagttttcggatctttcagaagctgtcggagatcttctca
gatgagaacaactactcattgagccgggagctgctcatcaaggaggggacctccaagttt
gccaccctggagatgaaccccaagagagcccagaaacggccaaaggagacgggcatcatc
cagggcaccgttccctacctgggcacgttcctcaccgacctggtgatgctggacaccgcc
atgaaggactatctgtatggcagactcatcaacttcgagaagaggaggaaggagttcgag
gtgatcgcccagatcaagctgctgcagtcagcctgcaacaactacagcatcacgccagat
gagcagtttggggtctggttccgggccgtagagcggctcagcgagactgagagctacaac
ctgtcgtgcgagctggagcccccatccgagtcagccagcaacaccctcaggaccaagaag
aacacagccattgtcaagcgctggagcgaccgccaggcccccagcactgagctcagtacc
agcggcagctcccactccaagtcctgtgaccagctcaggtgtggcccctacctcagcagc
ggggacattgctgacgcgctcagcgtgcactcagccggctcctccagctctgacgtggag
gagatcaacatcagcttcgtcccggagtcccctgatggccaggaaaagaagttctgggaa
tcagcctcacagtcgtccccggagacctccggcatcagctcggcctccagcagcacctcg
tcctcctcagcctccaccacacccgtggctgccacacgcacccacaaacgctccgtctca
gggctctgcaactccagctccgcgctgccgctctacaaccagcaggtgggcgactgctgc
atcatccgcgtcagcctggacgtggacaacggcaacatgtacaagagcatcctggtgacc
agccaagataaggctccggccgtaatccgcaaggccatggacaaacacaacctggaggaa
gatgagccggaggactatgagctgctgcagattctctccgatgaccggaagctgaagatc
cctgaaaacgccaatgtcttctatgccatgaactctaccgccaactatgactttgtcctg
aagaagcggaccttcaccaagggagtgaaggtcaagcatggagccagctcaaccctccct
cgcatgaagcagaaaggactcaagattgccaagggcatcttctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674726
Entry
104674726         CDS       T03989                                 

Definition
(RefSeq) ral-GDS-related protein-like
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04072  Phospholipase D signaling pathway
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104674726
   04015 Rap1 signaling pathway
    104674726
   04072 Phospholipase D signaling pathway
    104674726
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104674726
   05231 Choline metabolism in cancer
    104674726
  09162 Cancer: specific types
   05210 Colorectal cancer
    104674726
   05212 Pancreatic cancer
    104674726
SSDB
Motif
Pfam: RasGEF
Other DBs
NCBI-GeneID: 104674726
NCBI-ProteinID: XP_010377437
LinkDB
Position
13
AA seq 527 aa
MGSARQATDTSLPGSRALSLQSFTQQIKQELLDGFHFSIFLKEGQGPPATNHGQCCSGYE
NEICRMPTFQPGRGEKLLVSLVPVFLTKPISSYATCLGPSWDFITVPHFLELLIRSTTTS
ILFTWPPENTSVCCQTLQRSYFWIKLAFRTFTWPGLGLEDHQEIVLGQLVLLEPKEAKPE
DPAPPPGQHTLTMLVLEPAPPLLVDLRPALEPESRAALDAPGYLYSAPAPAPGEGPLPGT
VLEPQLAPESPYPSPGTVKTQPSEELPDITTFPPRLLAEQLTLMDAELLKKVELYECMGS
IWGQRHQKGSEHVAPTVCATIAHFKRLTNCVTTSCLGDHSMRAQDRARVVEHWIKVAREC
VSLNKFSSVHAIVSTLSSNPIHWLHKMWAGVSSKSTKYLKELCKKDTAVKRDLLIKTGSF
KVATQERNPQGAQTRLRRQKKGVVPFLGDFLIELHRLDSDILEYLDGNTNKRRKEVQVLW
EMQLLQVAAMNYRLRPLEKFLTCFSRMEQLSDKESYKLSCQLDPESQ
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggggtcagccaggcaggcgactgacacctctttgcccggctctcgggcactctctttg
cagagctttacacagcagatcaagcaggagctgttggatggattccatttctccatcttc
ctcaaagaagggcaggggccccctgctaccaaccacggccagtgctgctctgggtatgaa
aatgagatctgcaggatgccaactttccagcctggcagaggggagaagcttttggtgtcc
ctggttccagtctttctaactaaacccatctcatcttatgccacctgcctgggtccctcc
tgggactttatcaccgtgccacactttttggaactactcattagaagcaccaccacctcc
attttgttcacttggccccctgaaaacacttcagtttgctgccagaccctgcaacggtca
tatttctggataaagctggccttcaggaccttcacctggcctggactgggcttggaggac
catcaggaaattgtgctaggccagttggtgcttctggagcccaaggaggccaagccagaa
gatcctgctccacctcctgggcaacacacattaacaatgctggtcctggagccagcacca
ccactgctggtggacctgcggcctgctctggagccagagtcacgtgcagccctggatgca
ccaggatatctatattcagcaccagcaccagcaccaggggaagggccccttccaggaaca
gtgctggagccacagttagccccagagtccccctatccctctcccgggacagtcaagact
caacccagtgaggagctgcctgacatcacgaccttccctcccaggctgctggcagagcag
ctgaccctcatggatgcggagctgctcaagaaggtggagctctacgaatgcatgggctcc
atctggggccaacgacatcagaaggggagtgagcacgtggcacccacagtttgtgccacc
attgcacacttcaagaggctcaccaactgtgtcaccacctcctgcctcggggaccacagc
atgagggcccaggacagggccagggtggtggagcactggatcaaggtggccagggagtgc
gtaagcctcaacaaattctcctcagtgcatgccatcgtctctactctgagcagtaaccca
atacattggctacacaagatgtgggcaggagtgtccagcaaaagcacaaaatatttaaaa
gaactctgcaaaaaagacactgcagtgaagagggacctgctgatcaagacggggagcttt
aaggtggccacccaggagaggaacccccagggagcccagaccaggctgcggagacagaag
aagggcgtggtccccttcctgggggattttctgattgagttacacaggttggattcggac
atcctggaatatctggacggcaacaccaacaagaggaggaaggaggtccaagttctatgg
gaaatgcagctgctccaagtggctgccatgaattataggcttcggcctcttgagaaattt
ctcacctgtttctcaagaatggagcagctcagtgacaaggagagctacaagctgtcctgc
cagctggatcctgaatcccagtag

DBGET integrated database retrieval system