KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669912Help
Entry
104669912         CDS       T03989                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00020  Citrate cycle (TCA cycle)
rro00190  Oxidative phosphorylation
rro01100  Metabolic pathways
rro01200  Carbon metabolism
rro04714  Thermogenesis
rro04932  Non-alcoholic fatty liver disease (NAFLD)
rro05010  Alzheimer disease
rro05012  Parkinson disease
rro05016  Huntington disease
Module
rro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rro_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104669912 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104669912 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    104669912 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    104669912 (SDHB)
   05012 Parkinson disease
    104669912 (SDHB)
   05016 Huntington disease
    104669912 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    104669912 (SDHB)
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104669912 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 104669912
NCBI-ProteinID: XP_010371329
UniProt: A0A2K6R6N1
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVALSLRGRLPATTLGAACLQASRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMIATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggggccggttaccggccacaacccttggcgcg
gcctgcctccaggcctcccgaggagcccagacagctgcagccgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tacgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaaattgactcgactttgaccttcagaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccgcatatgtatgtgataaaggaccttgtt
cccgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggaaatcaagaaaatgatagcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system