KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104669984
Entry
104669984         CDS       T03989                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04066  HIF-1 signaling pathway
rro04114  Oocyte meiosis
rro04217  Necroptosis
rro04261  Adrenergic signaling in cardiomyocytes
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04916  Melanogenesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04934  Cushing syndrome
rro04971  Gastric acid secretion
rro05012  Parkinson disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05214  Glioma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104669984 (CAMK2G)
   04310 Wnt signaling pathway
    104669984 (CAMK2G)
   04066 HIF-1 signaling pathway
    104669984 (CAMK2G)
   04020 Calcium signaling pathway
    104669984 (CAMK2G)
   04024 cAMP signaling pathway
    104669984 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104669984 (CAMK2G)
   04217 Necroptosis
    104669984 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104669984 (CAMK2G)
   04922 Glucagon signaling pathway
    104669984 (CAMK2G)
   04912 GnRH signaling pathway
    104669984 (CAMK2G)
   04921 Oxytocin signaling pathway
    104669984 (CAMK2G)
   04916 Melanogenesis
    104669984 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    104669984 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104669984 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    104669984 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    104669984 (CAMK2G)
   04728 Dopaminergic synapse
    104669984 (CAMK2G)
   04720 Long-term potentiation
    104669984 (CAMK2G)
   04722 Neurotrophin signaling pathway
    104669984 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    104669984 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    104669984 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    104669984 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104669984 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104669984 (CAMK2G)
   05205 Proteoglycans in cancer
    104669984 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    104669984 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104669984 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    104669984 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    104669984 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104669984 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104669984 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104669984 (CAMK2G)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104669984 (CAMK2G)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   104669984 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Other DBs
NCBI-GeneID: 104669984
NCBI-ProteinID: XP_030796117
LinkDB
Position
11
AA seq 556 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKNSLVSPAQEPAPLQTAMEPQTTVV
HNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSRDRTAPSAGMQPQPSLCS
SAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENL
LSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKW
LNVHYHCSGAPAAPLQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctt
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaagagtac
gcagcaaaaatcatcaataccaagaagttgtctgcccgggatcaccagaaactagaacgt
gaggctcggatatgtcgacttctgaaacatccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttactggcggggagctgtttgaa
gacattgtggccagagagtactacagtgaagcagatgccagccactgtatacatcagatt
ctggagagtgttaaccacattcaccagcatgacatcgtccacagggacctgaagcctgag
aacctgctgctggcgagtaaatgcaagggtgccgctgtcaagctggctgattttggccta
gccatcgaagtacagggagagcagcaggcttggtttggttttgctggaaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctatcctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcaccagaatgggacacg
gtaactcctgaagccaagaacttgatcaaccagatgctgaccataaacccagcaaagcgc
atcacggctgaccaggctctcaagcacccgtgggtctgtcaacgatccacggtggcatcc
atgatgcatcgtcaggagactgtggagtgtttgcgcaagttcaacgcccggagaaaactg
aagggtgccatcctcacaaccatgcttgtctccaggaacttctcagctgccaaaagcctg
ttgaacaagaagtcggatggcggtgtcaagccacagagcaacaacaaaaacagtctcgta
agcccagcccaagagcccgcgcccttgcagacggccatggagccacaaaccactgtggta
cacaacgctacagatgggatcaagggctccacagagagctgcaacaccaccacagaagat
gaggacctcaaagctgccccgctccgcactgggaatggcagctcggtgcctgaaggacgg
agctcccgggacagaacagccccctctgcaggcatgcagccccagccttctctctgctcc
tcagccatgagaaaacaggagatcattaagattacagaacagctaattgaagccatcaac
aatggggactttgaggcctacacgaagatttgtgatccaggcctcacttcctttgagcct
gaggcccttggtaacctcgtggaggggatggatttccataagttttactttgagaatctc
ctgtccaagaacagcaagcctatccataccaccatcctaaacccacacgtccacgtgatt
ggggaggacgcagcgtgcatcgcctacatccgcctcacccagtacatcgacgggcagggt
cggcctcgcaccagccagtcagaagagacccgggtctggcaccgtcgggatggcaagtgg
ctcaatgtccactatcactgctcaggggcccctgccgcaccgctgcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670410
Entry
104670410         CDS       T03989                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04066  HIF-1 signaling pathway
rro04114  Oocyte meiosis
rro04217  Necroptosis
rro04261  Adrenergic signaling in cardiomyocytes
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04916  Melanogenesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04934  Cushing syndrome
rro04971  Gastric acid secretion
rro05012  Parkinson disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05214  Glioma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104670410 (CAMK2A)
   04310 Wnt signaling pathway
    104670410 (CAMK2A)
   04066 HIF-1 signaling pathway
    104670410 (CAMK2A)
   04020 Calcium signaling pathway
    104670410 (CAMK2A)
   04024 cAMP signaling pathway
    104670410 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104670410 (CAMK2A)
   04217 Necroptosis
    104670410 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104670410 (CAMK2A)
   04922 Glucagon signaling pathway
    104670410 (CAMK2A)
   04912 GnRH signaling pathway
    104670410 (CAMK2A)
   04921 Oxytocin signaling pathway
    104670410 (CAMK2A)
   04916 Melanogenesis
    104670410 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    104670410 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104670410 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    104670410 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    104670410 (CAMK2A)
   04728 Dopaminergic synapse
    104670410 (CAMK2A)
   04720 Long-term potentiation
    104670410 (CAMK2A)
   04722 Neurotrophin signaling pathway
    104670410 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    104670410 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    104670410 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    104670410 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104670410 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670410 (CAMK2A)
   05205 Proteoglycans in cancer
    104670410 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    104670410 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104670410 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    104670410 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    104670410 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104670410 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104670410 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104670410 (CAMK2A)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104670410 (CAMK2A)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   104670410 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 104670410
NCBI-ProteinID: XP_010371932
UniProt: A0A2K6PNT9
LinkDB
Position
3
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagctttctccgtggtgcgaaggtgtgtgaaggtgctggctggccaggagtatgct
gccaagatcatcaacaccaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatatgccgcctgctgaagcaccccaacattgtccgactccatgacagcatctca
gaggaaggacaccactacctgatcttcgacctggtcactggtggggaactgtttgaagat
atcgtggcccgggagtattacagtgaggcggatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgccgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggactcctggatacctc
tccccagaagtgctgcggaaggacccatacgggaagcctgtggacctgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccattctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagctggcgcctatgatttcccatcaccagaatgggacaccgtc
accccggaagccaaggatctgatcaataagatgctgaccattaacccatccaaacgcatc
acagctgccgaagcccttaagcacccctggatctcgcaccgctccaccgtggcatcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccattctcaccacgatgctggccaccaggaacttctctggagggaagagtggggga
aacaagaagagtgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcctcagagagcaccaacaccaccatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccctggcatgacagccttcgaacctgaggccctggggaacctggtt
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagccc
gtgcacaccaccatcctgaatccccacatccacctgatgggcgacgagtcagcctgcatc
gcctacatccgcatcacgcagtacctggacgccggcggcatcccacgcaccgcccagtcg
gaggagacccgtgtctggcaccgccgggacggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccactga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671146
Entry
104671146         CDS       T03989                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04066  HIF-1 signaling pathway
rro04114  Oocyte meiosis
rro04217  Necroptosis
rro04261  Adrenergic signaling in cardiomyocytes
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04916  Melanogenesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04934  Cushing syndrome
rro04971  Gastric acid secretion
rro05012  Parkinson disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05214  Glioma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104671146 (CAMK2B)
   04310 Wnt signaling pathway
    104671146 (CAMK2B)
   04066 HIF-1 signaling pathway
    104671146 (CAMK2B)
   04020 Calcium signaling pathway
    104671146 (CAMK2B)
   04024 cAMP signaling pathway
    104671146 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104671146 (CAMK2B)
   04217 Necroptosis
    104671146 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104671146 (CAMK2B)
   04922 Glucagon signaling pathway
    104671146 (CAMK2B)
   04912 GnRH signaling pathway
    104671146 (CAMK2B)
   04921 Oxytocin signaling pathway
    104671146 (CAMK2B)
   04916 Melanogenesis
    104671146 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    104671146 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104671146 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    104671146 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    104671146 (CAMK2B)
   04728 Dopaminergic synapse
    104671146 (CAMK2B)
   04720 Long-term potentiation
    104671146 (CAMK2B)
   04722 Neurotrophin signaling pathway
    104671146 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    104671146 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    104671146 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    104671146 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104671146 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671146 (CAMK2B)
   05205 Proteoglycans in cancer
    104671146 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    104671146 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104671146 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    104671146 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    104671146 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104671146 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104671146 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104671146 (CAMK2B)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104671146 (CAMK2B)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   104671146 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 104671146
NCBI-ProteinID: XP_030787962
LinkDB
Position
6
AA seq 667 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAAKSLLNKKADGVKPQTNST
KNSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSV
RRGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPLPCLS
PALLGPLPSPSPRISDILNSVRRGSGTPEAEGPLPVGPPPCPSPTIPGPLPTPSRKQEII
KTTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIH
TTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSG
APVAPLQ
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctatcagccagagatcaccagaagttggagaga
gaggctcggatctgccgccttctgaagcattccaatatcgtgcgtctccacgacagcatc
tccgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcgagagaatactacagcgaggctgatgccagtcactgcatccagcagatc
ctggaggccgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgctcctggccagcaagtgcaaaggggctgctgtgaagctggcagacttcggcctg
gctatcgaggtgcagggggaccagcaggcatggtttgggttcgctggcacaccaggctac
ctgtcccctgaggtccttcgcaaagaggcgtatggcaagcccgtggacatctgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggccggcgcctacgacttcccgtcccccgagtgggacacc
gtcactcctgaagccaaaaacctaatcaaccagatgctgaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcacccgtgggtctgccaacgttccacggtagcctcc
atgatgcacagacaggagactgtggagtgtctgaaaaagttcaatgccaggagaaagctc
aagggagccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gcagccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcacc
aaaaacagtgcagccgccaccagccccaaagggacgcttcctcctgccgccctggagcct
caaaccaccgtcatccataacccagtggacgggattaaggagtcttctgacagtgccaac
accaccatagaggatgaagacgctaaagcccccagggtccctgacatcctgagctcagtg
aggaggggctcgggagccccagaagccgaggggcccctgccctgcccatctccagctccc
tttagccccctgccagccccatcccccaggatctctgacatcctgaactctgtgagaagg
ggctcaggaaccccagaagccgagggccctctctcagcggggcccctaccctgcctgtct
ccggctctcctaggccccctaccctccccgtccccgaggatctctgacatcctgaactct
gtgaggaggggctcagggaccccagaagccgagggccccttaccagtggggcccccgccc
tgcccatctccgactatccctggccccctgcccaccccgtcccggaagcaagagatcatt
aagaccacggagcagctcatcgaggcggtcaacaacggtgactttgaggcctacgcgaaa
atctgtgacccaggactgacctcatttgagcctgaagcactgggcaacctggttgaaggg
atggacttccacagattctacttcgagaacctgctggccaagaacagcaagccgatccac
acgaccatcctgaacccgcacgtgcacgtcatcggagaggacgccgcctgcattgcttac
atccggctcacgcagtacattgacgggcagggccggccccgcaccagccagtctgaggag
acccgtgtgtggcaccgccgcgacggcaagtggcagaacgtgcacttccactgctcgggc
gcgcctgtggccccgctgcagtga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104676623
Entry
104676623         CDS       T03989                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro04020  Calcium signaling pathway
rro04024  cAMP signaling pathway
rro04066  HIF-1 signaling pathway
rro04114  Oocyte meiosis
rro04217  Necroptosis
rro04261  Adrenergic signaling in cardiomyocytes
rro04310  Wnt signaling pathway
rro04360  Axon guidance
rro04713  Circadian entrainment
rro04720  Long-term potentiation
rro04722  Neurotrophin signaling pathway
rro04725  Cholinergic synapse
rro04728  Dopaminergic synapse
rro04740  Olfactory transduction
rro04750  Inflammatory mediator regulation of TRP channels
rro04911  Insulin secretion
rro04912  GnRH signaling pathway
rro04916  Melanogenesis
rro04921  Oxytocin signaling pathway
rro04922  Glucagon signaling pathway
rro04925  Aldosterone synthesis and secretion
rro04934  Cushing syndrome
rro04971  Gastric acid secretion
rro05012  Parkinson disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05031  Amphetamine addiction
rro05152  Tuberculosis
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05214  Glioma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104676623 (CAMK2D)
   04310 Wnt signaling pathway
    104676623 (CAMK2D)
   04066 HIF-1 signaling pathway
    104676623 (CAMK2D)
   04020 Calcium signaling pathway
    104676623 (CAMK2D)
   04024 cAMP signaling pathway
    104676623 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104676623 (CAMK2D)
   04217 Necroptosis
    104676623 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104676623 (CAMK2D)
   04922 Glucagon signaling pathway
    104676623 (CAMK2D)
   04912 GnRH signaling pathway
    104676623 (CAMK2D)
   04921 Oxytocin signaling pathway
    104676623 (CAMK2D)
   04916 Melanogenesis
    104676623 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    104676623 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104676623 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    104676623 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    104676623 (CAMK2D)
   04728 Dopaminergic synapse
    104676623 (CAMK2D)
   04720 Long-term potentiation
    104676623 (CAMK2D)
   04722 Neurotrophin signaling pathway
    104676623 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    104676623 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    104676623 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    104676623 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    104676623 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104676623 (CAMK2D)
   05205 Proteoglycans in cancer
    104676623 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    104676623 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104676623 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    104676623 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    104676623 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104676623 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104676623 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104676623 (CAMK2D)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     104676623 (CAMK2D)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   104676623 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 104676623
NCBI-ProteinID: XP_010379794
LinkDB
Position
2
AA seq 513 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKEPQTTVIHNPDGNKESTESSNTTIEDEDVKAR
KQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKS
NKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVH
FHRSGSPTVPIKPPCIPNGKENFSGGTSLWQNI
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactagaaaga
gaagctagaatctgccgtcttttgaagcaccctaatattgtgcgacttcatgatagcata
tcagaagagggctttcactacttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcaagagaatactacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaattggcagactttggctta
gccatagaagttcaaggggaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctatattctacttgtggggtatccacccttctgggatgaagaccaacac
agactctatcagcagatcaaggccggagcttatgattttccatcaccggaatgggacacg
gtaactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgt
atcacagcctcggaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaagaaatttctcagcagccaagagtttg
ttgaagaaaccagatggagtaaaggagccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacga
aagcaagagattatcaaagtcactgaacaactgatcgaagctatcaacaacggggacttt
gaagcctacacaaaaatctgtgacccaggccttactgcttttgaacctgaagctctgggt
aatttagtggaagggatggattttcaccgattctacttcgaaaatgctttgtccaaaagc
aataaaccaatccacactattattctaaaccctcatgtacatctggtaggggatgatgcc
gcctgcatagcatatattaggctcacacagtacatggatggcagtggaatgccaaagaca
atgcagtcagaagagactcgtgtgtggcaccgtcgggatggaaagtggcagaatgttcat
tttcatcgctcggggtcaccaacagtacccatcaagccaccctgtattccaaatgggaaa
gaaaacttctcaggaggcacctctttgtggcaaaacatctaa

DBGET integrated database retrieval system