KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670138
Entry
104670138         CDS       T03989                                 

Gene name
NKX2-5
Definition
(RefSeq) homeobox protein Nkx-2.5 isoform X1
  KO
K09345  homeobox protein Nkx-2.5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Brite
KEGG Orthology (KO) [BR:rro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104670138 (NKX2-5)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104670138 (NKX2-5)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 104670138
NCBI-ProteinID: XP_010371637
UniProt: A0A2K6RGA7
LinkDB
Position
3
AA seq 325 aa
MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLATFKPEAYAGPE
AAAPGLPELRAELGPAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAV
ELEKPEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTST
QVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAP
AYGVGLNAYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATATANNNFVNFGVGD
LNAVQSPGIPQSNSGVSTLHGIRAW
NT seq 978 nt   +upstreamnt  +downstreamnt
atgttccccagccctgcgctcacgcccacgcccttctcagtcaaagacatcctgaacctg
gagcagcagcagcgcagcctggccgccgccggagaactctctgcgcgcctggaggccacc
ctggcgccctcctcctgcatgctggccaccttcaagccagaggcctacgccgggcccgag
gcggctgcgccgggcctcccagagctgcgcgcagagctgggccccgcgccttcacccgcc
aagtgtgcttctgcctttcccgccgcccccgccttctatccgcgtgcctacagcgaccca
gacccagccaaggaccctcgagccgaaaagaaagagctgtgcgcgctgcagaaggcggtg
gagctggagaagccagaggcggacaacgcggagcggccccgggcgagacggcggaggaag
ccgcgcgtgctcttctctcaggcgcaggtctatgagctggagcggcgcttcaagcagcag
cggtacctgtctgcccccgaacgcgaccagctggccagcgtgttgaaactcacgtccacg
caggtcaagatctggttccagaaccggcgctacaagtgcaagcggcagcggcaggaccag
actctggagctggtggggctgcccccgccgccgccgccgccgcctgcccgcaggatcgcc
gtgccagtgctggtgcgcgatggcaagccatgcctaggggactcggcaccctacgcgcct
gcctacggcgtgggcctcaatgcctacggctataacgcctaccccgcctatccgggttac
ggcggcgcggcctgcagccctggctacagctgcaccgccgcttaccccgccgggccttct
ccagcgcagccggccactgccaccgccaacaacaacttcgtgaacttcggtgtcggggac
ttgaatgcggttcagagccccgggattccgcagagcaactcgggagtgtccacgctgcat
ggtatccgagcctggtag

DBGET integrated database retrieval system