KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670235
Entry
104670235         CDS       T03989                                 

Gene name
RALBP1
Definition
(RefSeq) ralA-binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04014  Ras signaling pathway
rro05200  Pathways in cancer
rro05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    104670235 (RALBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670235 (RALBP1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104670235 (RALBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104670235 (RALBP1)
Membrane trafficking [BR:rro04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    104670235 (RALBP1)
SSDB
Motif
Pfam: RhoGAP Nod1
Other DBs
NCBI-GeneID: 104670235
NCBI-ProteinID: XP_010371725
UniProt: A0A2K6P3V3
LinkDB
Position
21
AA seq 655 aa
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDI
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
IDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESTNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV
QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVVLKQVTKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEECSS
ESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRVK
AEQQAQEDQEPDWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgactgagtgcttcctgcccccgacaagcagccccagtgaacaccgcagggtggagcat
ggcagcgggcttacccggacccccagctctgaagagatcagccctactaagtttcctgga
ttgtaccgcactggagagccttcacctccccatgacatcctccatgagcctcctgatata
gtgtctgatgatgagaaagatcatgggaagaaaaaagggaaatttaagaaaaaggaaaag
aggactgaaggctatgcagcctttcaggaagatagctctggagatgaggcagaaagtcct
tctaaaatgaagaggtccaagggtatccatgttttcaagaagcccagcttttctaaaaag
aaggaaaaggattttaaaataaaagagaaacccaaagaagaaaagcataaagaagaaaag
cacaaagaagaaaaacataaagagaagaagtcgaaagacttgacagcagctgatgttgtt
aaacagtggaaggaaaagaagaaaaagaaaaagccaattcaggagccagaggtgcctcag
attgatgttccaaatctcaaacccatttttggaattcctttggctgacgcagtagagagg
accatgatgtacgatggcattcggctgccagccgttttccgtgaatgtatagattacgta
gagaagtatggcatgaagtgtgaaggcatctacagagtatcaggaattaaatcaaaggtg
gatgagctaaaagcagcctatgaccgggaggagtccacaaacctggaagaatatgagcct
aacactgtagccagtttgctgaagcagtatctgcgagaccttccagagaacttgcttacc
aaagagcttatgcccagatttgaagaggcttgtgggaggaccacggagactgagaaagtg
caggaattccagcgtttactcaaagaactgccagaatgtaactatcttctgatttcttgg
ctcattgtgcacatggaccatgtcatcgcaaaggaactggaaacaaaaatgaatatacag
aacatttctatagtgctcagcccaactgtgcagatcagcaatcgagtcctgtatgtgttt
ttcacacatgtgcaagaactctttggaaatgtggtactaaagcaagtgacgaaacctctg
cgatggtctaacatggccacgatgcccacactgccggagacccaggcgggcatcaaggag
gagatcaggagacaggagtttcttttgaattgtttacatcgagatctgcagggtgggata
aaggatttgtctaaagaagaaagattatgggaagtacaaagaattttgacagccctcaaa
agaaaactgagagaagctaaaagacaggagtgtgaaaccaagattgcacaagagatagcc
agtctttcaaaagaggatgtttccaaagaagagatgaatgaaaatgaagaagttataaat
attctcctggctcaggagaatgagatcctgactgaacaggaggagctcctggccatggag
cagtttctgcgccggcagattgcctcagaaaaagaagagatagaacgcctcagagccgag
attgccgaaattcagagtcgccagcagcacggccggagcgagaccgaggagtgctcctcc
gagagcgagagtgagagcgaggatgaggaggagctgcagatcattctggaagacttacag
agacagaacgaagagctggaaataaagaacaatcatttgaatcaagcaattcatgaggag
cgtgaggcgatcatcgagctgcgcgtgcagctgcggctgctccagatgcagcgggtcaag
gccgagcagcaggcgcaggaggaccaggagcctgattggcgcgggggtgccgtccagccg
cccagagacggcgtcctcgagccaaaagcagctaaagagcagccaaaggcaggcaaggag
ccggcgaagccatcgcccagcagggacaggaaggagacgtccatctga

DBGET integrated database retrieval system