KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670351
Entry
104670351         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00280  Valine, leucine and isoleucine degradation
rro00350  Tyrosine metabolism
rro00380  Tryptophan metabolism
rro00750  Vitamin B6 metabolism
rro00760  Nicotinate and nicotinamide metabolism
rro00830  Retinol metabolism
rro00982  Drug metabolism - cytochrome P450
rro01100  Metabolic pathways
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104670351
   00350 Tyrosine metabolism
    104670351
   00380 Tryptophan metabolism
    104670351
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    104670351
   00760 Nicotinate and nicotinamide metabolism
    104670351
   00830 Retinol metabolism
    104670351
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    104670351
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670351
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     104670351
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 104670351
NCBI-ProteinID: XP_010371856
LinkDB
Position
14
AA seq 1326 aa
MPSLPHSDELIFFVNGRKVIERNADSEVNLLFYVRKRLRLTGTKYSCGGGGCGACTVMVS
RYNSTTKAIHHYPATACLVPICSLYGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPEQITKALGGNLCHCTGYRPIVESGKTFCVESTVCELKGSG
KCCMDQEDGSLVNRWEQMCTKLYDEDEFQPLDPSQEPIFPPELIRMAEDPXQGERTTWIT
PATLNDLLELKANFPKAPLVMGNTELGPSIKFKNEFHPVFISPLGLPELHFVNTTDDGVT
IGAGYSLAQLNDALHFIVSEQPKEKTKTHRALLKHLRTLAGAQIRNMATLGGHVVSRPNF
SDLNPILAAGNAAINLVSKEGQWQIPLNGPFLERSPEADLKSEEIVSSVYIPYSTQWHFV
FGLRMAQRQENAFAIVNAGMSVKFEDGTNTIKELQMFYGSVGPTTVSASQTCKQLIGRQW
DDQMLSDACRWVLDEIYIPPAAEGGMVEYRRTLIISLLFKFYLKVRRGLNQMDPQKFPNI
PEKFMSALEDFPIETPQGIQMFQCVDPHQPPQDPVGHPVMHQSAIKHTTGEAVYIDDMSC
IDQELFLAPITSTRAHAKIISIDISEALALPGVVDVITAEDVPGDNNYQGEIFYAQNEVI
CVGQIVSTVAADTYAHAREAAKKVKITYGDIEPRIITIEQALEHNSFLFDEKKIEQGNVE
QAFKYKSLKGSEVHVEGQEHFCMETLSILALPKEDKEMVLHLGTQYPTRVQEYVAAALNV
PRNRIACRMKRTGGAFGGKVAKPAVLGAVSAVAANKTGRPIRFILERGDDMLITAGRHPL
LGKYKIGFMNNGVIKAADVKYYVNGRCTPDESEMVVEFIVLKSENAYYIPNFRCRGRACK
TNPSNTAIRGFGFPQGTVVVEAYITAVASQCNLPPEEVKEINMYKRISKTAFKQTFNPEP
LQRCWKECLEKSSFYARKLAAEEFNKKNYWKKRGLAIFPMKFSIGIPTAYYNQAAALVHI
YLDGSVLVTHGGYELGQGLYTKMIQVASHELNIPQSYIHLSETSTVTVSNGVLTLGSMGT
DINGKAVQNACQTLMARLHPIIRKNPKGKWEDWIAKAFEESISLSATGYFKGYQTNMDWE
KGEGNAYPYYVYGAACSEVEVDCLTGAHKLLRTDIFMEAAFSINPALDIGQIEGAFIQGM
RFYTIEELKYSPEGVLYSQSPDDYKIPTITEIPEEFYVTLVRSQNPIAIYSSKGLGEAGM
FLGSSVLFAIYDTVAAARRERGLAKTFVLSSPATPEMIRMMCVDQFTDMIPRDDPSTFTP
WSIRVS
NT seq 3981 nt   +upstreamnt  +downstreamnt
atgccttcccttccccattctgatgagctgatttttttcgtgaatggaagaaaggtgata
gagaggaatgctgattctgaagtaaatctactgttctacgtgaggaaaagacttcgtctt
acaggcactaaatattcctgtggaggaggaggctgcggtgcctgtacagtaatggtgtca
agatacaactccacgaccaaggcgatccaccattatccagcaacggcgtgcctggtaccc
atctgctctctgtatggggctgcagtcaccaccgtggaaggtgtgggaagcatcaaaacc
aggattcaccctgtgcaggaaagacttgccaagtgtcatggcacgcagtgtggattctgc
agcccagggatggtgatgtccatctacacactgctgaggaatcacccggagccaacccct
gagcagatcaccaaagctctgggaggtaatttgtgccactgcactggataccgaccaatt
gtagaaagtggaaaaactttctgtgtggaatcaactgtttgtgaactgaaaggatcagga
aaatgttgcatggatcaagaagatgggtctttggtgaatagatgggaacaaatgtgcacc
aaactgtacgatgaagacgaattccagcccttggatccatcccaggagcctatattccct
cctgaactcataagaatggcagaagatccanaacaaggggagagaaccacatggatcacc
cctgcgaccctgaacgaccttctggagctgaaagccaatttccccaaagccccgcttgtc
atgggaaacacagaattgggacccagcattaaattcaaaaatgaattccatccagttttt
atatctccacttgggcttccagaactacattttgtgaacaccacagatgatggggtgaca
ataggtgcgggatacagcctagcccagttgaatgatgccttacattttatcgtttcggag
caaccgaaggagaagactaagacccatcgagctctgctgaagcatctgaggacacttgca
ggagcccagattaggaatatggccactttaggaggacatgtggtaagccggcctaatttt
tctgacctaaaccccattttagcagcaggaaatgctgccatcaatctggtatctaaagaa
ggacaatggcagattcctttaaatggtcctttccttgagagatcacctgaggcggacttg
aaatcagaagagattgtgtcatctgtttatattccctactccactcagtggcactttgtg
tttggactccggatggctcagcgtcaggagaacgcatttgccatcgtcaatgctgggatg
agcgtgaagtttgaagatggcacaaacacaatcaaggaacttcaaatgttctatggaagc
gtgggccccaccactgtctctgcaagccaaacctgcaagcagctcattgggaggcaatgg
gatgaccaaatgctgagtgatgcctgcagatgggtcctggatgagatctatatcccacca
gcagctgagggtggcatggtggagtataggcgaaccctcatcatcagcctcctcttcaaa
ttctacctgaaagtgaggcgaggactgaatcaaatggatccccagaagtttcccaacatt
ccagaaaagttcatgagtgctctagaagactttcccatagaaacaccccaaggaattcag
atgtttcagtgtgtggatccccaccaacccccacaagatccagttggacacccagtcatg
caccagtcggccattaaacacaccacaggggaagccgtatatattgatgacatgtcctgc
attgaccaagaactcttcctggctccaatcaccagcaccagagctcatgcaaagatcata
tcaattgatatttcagaagccctggcacttccaggtgttgttgacgtgataacagcagag
gatgttccaggagataataactatcaaggagagattttctatgcacagaatgaggtaatt
tgcgtgggtcagatcgtcagcactgtggctgctgatacctatgctcatgcaagagaggca
gccaaaaaagtgaagatcacttatggagacatagagccaaggattatcacaatagagcaa
gccctagagcacaattcatttctttttgatgagaaaaaaatcgagcaaggaaatgtagag
caagcctttaaatacaaatcattgaagggaagtgaagtccatgtggaaggacaggaacat
ttttgtatggaaacattgtctatcctagctctcccaaaagaagataaagaaatggtgtta
caccttggaacacagtatccaacccgcgtgcaggaatatgtggctgcagcactgaacgtc
ccaaggaatagaatcgcctgccgcatgaaaagaactggaggagcgtttggagggaaagtg
gccaagcctgctgtgttaggagctgtcagtgctgtggccgccaacaagactggccgtcca
atccggtttatcctagaacgtggtgatgacatgctgataactgctggccgccacccactc
ctcggaaaatacaaaattggattcatgaacaatggtgtgataaaagctgctgatgtcaaa
tactacgtcaatggcaggtgcactcctgatgagtctgagatggtggtggagttcattgtg
ctgaaatctgaaaatgcatactatattcctaatttccggtgccggggtagggcttgcaaa
acaaatccatccaacacagccattcgaggatttggctttcctcagggtacggtggtagtc
gaagcttacataactgccgtggcatctcaatgcaacttaccccctgaagaggttaaagaa
ataaacatgtataagagaattagcaaaacagcctttaagcagacatttaatccagagcca
ttgcaaagatgctggaaagaatgtctggagaaatcttcgttctatgctaggaaactggcc
gcagaggaatttaacaaaaagaattactggaagaagaggggacttgccatattccccatg
aaattttccattgggatccccacagcttactacaatcaggcggcagctctcgttcacatc
tatctagatggctctgtcttggtgactcatggtggctatgaactgggacaaggcctgtat
accaaaatgattcaggtggctagtcatgaactcaatatcccccagtcatacatacacctg
tctgaaacaagcacagtcacagtgtccaatggcgtcctcacattgggatcaatggggaca
gacatcaatggaaaggctgtgcagaatgcctgccaaactcttatggcccgtcttcatccc
atcatcaggaaaaaccctaaaggaaaatgggaggattggattgcaaaagcctttgaagaa
tccatcagtctctcagctactggatatttcaaaggctaccagacaaatatggactgggag
aagggggagggtaatgcttacccgtattatgtttatggagcagcctgttctgaggttgaa
gtcgactgtctcacgggggctcataagcttcttaggaccgacatcttcatggaggctgct
ttcagcataaacccagccctggatattggacagattgagggagcatttattcaaggcatg
agattctataccatagaagaactgaaatactccccagaaggtgtgctttattctcagagt
ccagatgactacaaaatccccaccatcactgagataccagaagagttctatgtcaccttg
gtgcgttcccaaaatcccatagccatctactcatccaagggattgggtgaggctggaatg
ttcttggggtcctcggtgttgtttgccatatatgacacagtggctgctgcccgcagagag
agggggctagccaagaccttcgtcctgagtagcccggcaacccctgagatgattcggatg
atgtgtgtggatcagttcaccgacatgattcccagagatgacccttcaacatttacacct
tggtccatccgtgtgtcttaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670357
Entry
104670357         CDS       T03989                                 

Definition
(RefSeq) aldehyde oxidase 1 isoform X2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00280  Valine, leucine and isoleucine degradation
rro00350  Tyrosine metabolism
rro00380  Tryptophan metabolism
rro00750  Vitamin B6 metabolism
rro00760  Nicotinate and nicotinamide metabolism
rro00830  Retinol metabolism
rro00982  Drug metabolism - cytochrome P450
rro01100  Metabolic pathways
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104670357
   00350 Tyrosine metabolism
    104670357
   00380 Tryptophan metabolism
    104670357
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    104670357
   00760 Nicotinate and nicotinamide metabolism
    104670357
   00830 Retinol metabolism
    104670357
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    104670357
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670357
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     104670357
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 104670357
NCBI-ProteinID: XP_010371869
UniProt: A0A2K6RFN7
LinkDB
Position
14
AA seq 1338 aa
MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYN
PITNRIRHHPANACLIPICSLYGTAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPG
MVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCETSGCCQSKENGVCC
LDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQPQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHT
YNGLTLGAGLSLAQVKDILADVVQKLPEEKTQTYHALLKHLGTLAGSQIRNMASLGGHII
SRHPDSDLNPILVVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSR
KLEFVSAFRQAQRQENALAIVNSGMRVFFGEGHGIIRELSISYGGVGPATICAKNSCQKL
IGRHWNEEMLDTACRLVLEEISLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPV
HYPSLADKYESALEDLHSKHHYSTLKYQHIGPKQHPEDPIGHPIMHLSGVKHATGEAIYC
DDMPPVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVDIMTAEHLSDVNSFCFFTEAE
EFLATDKVFCVGQLVCAVLADSEVQAKRAAKQVKIVYQDLEPLILTIEEAIQHNSFFEPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPRGEDQEMDVYVSTQFPKY
IQDIVASTLKLPANKVMCHVRRVGGAFGGKAFKTGVIAAITAFAANKHGRAVRCVLERGE
DMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGTSLDESLLVIEMGLLKMDNAYKF
PNLRCRGWACRTNLPSNTAFRGFGFPQAGLITESCIMEVAAKCGLSPEKVRMINMYKEID
QTPYKQEINAKNLIQCWRECMAVSSYSLRKAAVEKFNAENYWKKKGLAIVPLKYPVGLGS
RAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELGMPISNVHLRGTSTETV
PNANVSGGSVVADLNGLAVKDACQTLLKRLKPIISKNPKGTWKDWAQTAFDESISLSAVG
YFRGYESDINWEKGEGHPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGVLHTRGPDQYKIPAICDTPTEFHISLLPPSENSN
TLYSSKGLGESGVFLGCSVFFAIHDAVNAARRERGLHGPLSLNSPLTPEKIRMACEDKFT
KMIPRDEPGSYVPWNVPI
NT seq 4017 nt   +upstreamnt  +downstreamnt
atggacagggcgtccgagctgctcttctacgtgaacggccgcaaggtgatagaaaaaaat
gttgatcctgaaacaatgctgttgccttatctgaggaagaatcttcgactcacgggaact
aagtatggctgtggaggaggaggctgtggtgcttgtacagtgatgatatcacgatataac
cccatcaccaacaggataaggcatcacccagccaatgcctgtctgattcccatctgttct
ctgtatggtactgccgtcaccacagtagaaggcataggaagcacccacaccagaattcat
cctgttcaggagaggatcgccaagtgtcacggcacccaatgtggcttctgcacacccggg
atggtgatgtccatctacacgctgctcaggaaccacccggagcccactctggatcagctg
actgatgcccttggtggtaacctgtgccgttgcactggatacaggcccataattgatgca
tgcaagactttctgtgaaacttcgggctgctgtcaaagtaaagaaaatggagtttgctgt
ttggatcaaggaatcaatggattgccagaatttgaggaaggaagtaagacaagtccaaaa
ctcttcgcagaagaggagtttctgccattggatccaacccaggaactgatatttcctcct
gagctaatgataatggctgagaaacaaccgcaaaggaccagggtgtttggcagtgagaga
atgatgtggttttcccccgtgaccctgaaggaactgctggaatttaaattcaagtatccc
caggcccctgtcatcatgggaaacacctctgtggggcctgaagtgaaatttaaaggcgtc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaaccataca
tataatggactcacccttggtgctggtctcagcctagcccaggtgaaggacattttggct
gatgtagtccagaagcttccagaggagaagacacagacgtaccatgctctcctgaagcat
ttgggaaccctggctgggtcccagatcaggaacatggcttctttagggggacacatcatt
agcaggcatccagattcagatctgaatcccatcctggttgtgggtaactgtaccctcaac
ttgctatcaaaagaaggaaaacgacagattcctttaaacgagcagttcctcagcaagtgc
cctaatgcagatcttaagcctcaagaaatcttggtctcagtgaacatcccctactcaagg
aagttggaatttgtgtcagccttccgacaagcccagcgacaggagaatgcactagcaata
gtcaattcaggaatgagagtcttttttggagaagggcatggcattattagagagttatcc
atctcatatggaggcgttggtccagccaccatctgtgccaagaattcctgccagaaactc
attggaaggcactggaatgaagaaatgctggatacagcttgcaggcttgttctggaggaa
atctcccttttgggctcagcaccaggtggaaaggtggagttcaagaggactctcatcatc
agcttcctcttcaagttctacctggaagtgtcacaaattttgaaaaagatggacccagtt
cactatcctagccttgcagacaagtatgaaagtgctttagaagatcttcattccaaacat
cactacagtacattaaagtaccagcatataggcccaaagcagcatcctgaagacccaatt
ggccaccccatcatgcatctgtctggtgtgaagcatgccacgggggaggccatctactgt
gatgatatgcctccggtggaccaggaacttttcttgacttttgtgactagttcaagagct
catgctaagattgtgtctattgatctgtcagaagctctcagcatgcccggtgtggtggac
atcatgacagcagaacatcttagtgacgtcaactccttctgctttttcaccgaagctgag
gaatttctggcaacagataaggtgttctgtgtgggtcagcttgtctgtgccgtgcttgct
gattctgaggttcaggcaaagcgagctgctaagcaagtgaagattgtctatcaagatttg
gagccactgatcctaacaatcgaggaagctatacaacacaactcgttcttcgagccagaa
aggaaactggaatatggaaatgttgatgaagcatttaaagtggttgatcaaattcttgaa
ggtgaaatacatatgggaggtcaagaacatttttatatggaaacccaaagcatgcttgtt
gttcccaggggagaggatcaagaaatggatgtctacgtgtctacacagtttcccaaatat
atacaggacattgttgcctcgaccttgaagctcccggctaacaaggtcatgtgccatgta
aggcgtgttggtggagcatttggagggaaggcgttcaaaaccggagtcattgcagccatc
actgcatttgccgcaaacaaacatggccgtgcagttcgctgtgttctggaacgaggagaa
gacatgttaataactggaggccgccatccttaccttggaaagtacaaagctggattcatg
aatgatggcagaatcttggccctggacatggagcattatagcaatgcaggcacctccttg
gatgaatcattattggtgatagaaatgggacttctgaaaatggacaatgcttacaagttt
cccaacctccgctgccggggttgggcatgcagaaccaaccttccatccaacacggctttt
cgtgggtttggctttcctcaggcagggctgatcaccgaatcttgtatcatggaagttgca
gccaaatgtggactatcccctgagaaggtgcgaatgataaacatgtacaaggaaattgat
caaacaccctacaaacaagagatcaatgccaagaacctgatccagtgttggagagaatgt
atggccgtgtcttcctactccttgaggaaagcggctgtggaaaaatttaatgcggagaat
tactggaagaagaaaggactggccatagtccccctgaagtatcctgttggccttggctca
cgcgctgctggtcaggctgctgccttggttcacatttatcttgatggctctgtgctggtc
actcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtcagc
cgtgaattaggaatgccaatttcgaatgtccacctgcgtggaacaagcacagaaaccgtc
cctaatgcaaatgtctctggaggttctgtggtggcagatctcaacgggttggcagtaaag
gatgcctgtcaaactcttctaaaacgcctcaaacccatcatcagcaagaatcctaaagga
acttggaaagactgggcacagactgcttttgatgaaagcattagcctttcagctgttgga
tacttcagaggttatgagtcagacataaactgggagaaaggcgaaggccatcccttcgaa
tacttcgtttatggagctgcctgttccgaggttgaaatagactgcctgacgggggatcat
aagaacatcagaacagacattgtcatggatgttggctgcagtataaatccagccattgac
ataggccagattgaaggtgcatttattcaaggcatgggactttatacaatagaagaactg
aattattctccccagggcgttctgcacactcgtggtccagaccaatataaaatccctgcc
atctgtgacacacccacagagtttcacatttctttgttgcctccctctgaaaactcaaat
actctttattcatctaagggtctgggagagtcgggggtgttcctggggtgttccgtgttt
ttcgctatccatgatgcggtgaatgcagcacgacgggagagaggcctgcacggacccttg
agccttaatagtccactgaccccggagaagattaggatggcctgtgaagacaagttcaca
aaaatgattccgagagatgaacctgggtcctatgttccttggaatgtacccatctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670457
Entry
104670457         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: aldehyde oxidase 2-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00280  Valine, leucine and isoleucine degradation
rro00350  Tyrosine metabolism
rro00380  Tryptophan metabolism
rro00750  Vitamin B6 metabolism
rro00760  Nicotinate and nicotinamide metabolism
rro00830  Retinol metabolism
rro00982  Drug metabolism - cytochrome P450
rro01100  Metabolic pathways
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    104670457
   00350 Tyrosine metabolism
    104670457
   00380 Tryptophan metabolism
    104670457
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    104670457
   00760 Nicotinate and nicotinamide metabolism
    104670457
   00830 Retinol metabolism
    104670457
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    104670457
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104670457
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     104670457
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 104670457
NCBI-ProteinID: XP_030772199
LinkDB
Position
14
AA seq 1366 aa
MPCASRSDELVFFVNGRKVMERNVDPEGTLLTFLRKNWTLLSKSWLLRLTGTKYACGRGG
CGACTVMVSKHDPVSRKIRHFSVTACLMPICSLYGAAVTTVEGVGSIKTRLPPVQERIAK
SHGTQCGFCTPGMVMSMYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPILESGRTFCMES
NSCQQKGTGKCCLDWGENDSSSLGKKSEICTKLFAKEEFQSLDPTQELIFPPELLRMAEN
PEKRTLTFYGERVTWISPGTLKDLLELKVKHPKAPLVLGNTSLGKXLPRPAMKSQGHFHP
VLLSPARISELSMVTKTSDGLTIGAGCSLAQMQDILAERIAELPEEKTQTYRDLLKHLRS
LAGQQIRNMASLGGHVISRHCCSDLNPFLAVSNATLNLISAEGTRQIPLNEHFLAGLASA
DLKPKEILESVHIPHSQKWEFVSAFRQAQCQQNALPHVNAGMRVLLKESTDSIEDLSIAC
GGVGAATISAHRSCQLLLGRHWNELMLDEACRLLLDEVSLPGSAPGGRVEFKRTLVVSFL
SKFYLEFLQELKKLVKLFSVPDSRHHSEVSDQFLSALEDFLVTIPQGVQTYQNVDPHQPL
QDPVGRPIMHLSALKHATGEAMFCDDIPMVDKELFMALVTSSRAHAKIISIDVSKALELP
EVVDVITAEDIPGTNGAEGDKLLAVDEVNCVGQIISAVVAETDVQAKRATEKIEITYEDL
EPVIFTIKDAIKYNSFLCPEKKLEQGNVEEAFEKVDQILEGEVHVGGQKHFYMETQRVLV
IPKTEDKELDIYVSTQDPAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKVGKPAVFGAI
AAVGAIKTGHPIRLVLDREDDMLITGGRHHPNNWELPVFGKYKVGFMNNGRIKALDIECY
INGGCTLDDSELVTEFLILKLENAYKIHNLRFQGRACMTNLPSNTAFRGFGFPQGAQVTE
SCITAMAAKCGLPPEKIREKNMYKTVDKTIYKQAFNPETLIRCWNECLDKSSFYSRRMHV
EEFNKKNYWKKKGIAIIPMKFSVGFAATSYHQAAALVHIYTDGSVLVTHGGNELGQGIHT
KMLQVASRELKIPMSCMHISETSTATVPNTIATAASISADVNGRAVQNACQILLKRLEPI
IKKHPEGTWEDWIEAAFEQRISLSATGYFRGYKAFMDWEKRVGDPFPYYVYGAACSEVEI
DCLTGAHKKIRTDIIMDACCSLNPAIDIGQIEGSFIQGMGLYTTEELKYSPEGVLYSRSP
DEYKIPTITDAPEEFNVSLLPSSQTPLTIYSSKGLGESGMFLGSSVFFAIADAVATVXRE
RDIAEDFMVQSPATPERVRMACADRFTEMIPRDDPETFKPSSIPIA
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgccttgcgcgtcacgatcagacgagctggttttcttcgtgaacgggaggaaggtgatg
gagaggaatgtggacccagaagggactctgctgaccttcctacgaaagaactggaccctt
ttgtcaaagtcctggctgttacgcctcacaggaaccaagtacgcctgcggaagaggaggc
tgcggcgcctgcaccgtgatggtgtccaagcatgaccccgtgtccaggaagataagacac
ttctctgtcactgcgtgcctgatgcccatctgctctctgtatggagctgctgtcaccacc
gtggaaggtgttggaagcatcaaaaccaggcttccccctgtgcaggagcgtatcgccaag
agccacggcacccagtgtggattctgcacccctgggatggtgatgtccatgtacacactg
ctcaggaaccacccacagccctcggaggagcagctcatggaagccttggggggtaatcta
tgccgctgcactgggtatcggccaatacttgagagtggaaggactttctgcatggagtca
aatagctgtcaacagaaaggaacgggaaaatgctgcttggattggggagaaaatgactct
tcctcacttggcaagaaaagtgagatttgcacgaagttatttgcaaaagaggagtttcaa
tccttggacccaacccaggagctcatatttcccccagaactcttgaggatggcagagaat
ccagaaaaacgaacactgaccttctatggagagagagttacctggatctctcctgggacc
ctcaaggatctcctggagctgaaagtgaaacaccctaaggcccctcttgttctgggcaac
acctcactggggaagtgattacccagacctgcaatgaaatctcaaggacattttcatcca
gttctcctctctcctgcaaggatctctgagctgagtatggtgacaaaaacaagtgatgga
ctgacaataggcgctggctgcagcctggcccagatgcaggacatcttggctgagaggata
gctgagctcccagaggagaaaacacagacgtaccgagacctcctgaagcacctgaggagt
cttgcaggccagcagatccggaatatggcatccttagggggccatgtgataagccggcat
tgctgttcagacctgaatccatttcttgctgtgagcaacgctaccctcaatctgatttca
gcagaaggtacgcggcagattcctctaaatgaacattttcttgctgggttggcaagtgca
gaccttaagccaaaggaaattttggaatctgtgcatatcccgcactctcaaaagtgggaa
tttgtgtccgccttccgacaggctcagtgccagcagaacgccttgccccacgtgaatgct
ggcatgcgagtccttctcaaagaaagcacagacagcattgaggatctgagcatcgcctgt
ggaggggtgggggctgccaccatcagtgcacacagatcctgccagctgctcctcgggagg
cactggaatgagttgatgctggatgaggcttgcaggctgcttctggatgaagtctcgctc
ccaggctcagccccaggtggccgggtggaattcaagaggaccctagtcgtcagcttcctc
tccaaattctacctagagtttctgcaggaactgaagaagctggtgaagctgttctctgtg
cctgacagccgtcatcattctgaagtttcagaccaattcctaagtgctctcgaagatttc
ctagtcacaataccccagggagtccaaacgtaccagaatgtggatcctcaccagcccctc
caagacccagttggacgccccatcatgcacctgtcagctcttaaacatgccactggggaa
gccatgttttgtgatgacattcccatggtagataaagaacttttcatggctttggtgacc
agtagcagggctcatgcaaaaatcatatcaattgatgtgtccaaggctcttgaactaccg
gaagtggttgatgtgataacagctgaagatattccaggcaccaatggtgctgaaggtgac
aaactgctggctgtagatgaggtaaactgtgtgggccagatcatcagtgctgtggttgct
gagacagatgtacaggcaaaacgagcaactgaaaagatagagatcacctatgaagatctg
gaacctgtaatcttcaccattaaggatgccataaaatacaattcattcctgtgcccggaa
aaaaaacttgaacaaggaaatgttgaggaggcctttgaaaaagtcgaccaaattcttgaa
ggagaggtccatgttggaggacagaaacatttttacatggaaacgcaaagagtgcttgtt
attccaaagacagaggacaaagaactggacatttatgtgtccacacaggacccagcccac
gtgcagaaaacagtgtcttccactttaaacatccccatcaacaggatcacctgtcatgta
aaacgagtgggtggaggttttggagggaaggtaggaaaaccagctgtattcggggcgatt
gcagctgtgggtgccatcaaaacaggtcatcccattcgtcttgtccttgatcgtgaagac
gatatgttaataactggaggaaggcaccatccaaataactgggagttaccagtatttgga
aaatataaagtaggattcatgaacaacgggcggatcaaagctctagacattgagtgctat
attaacggaggatgcacgctggacgactctgagctggtaacagaatttctaatactaaag
ctggaaaatgcatataaaattcacaacctcaggttccagggccgtgcatgcatgacaaat
ttaccatccaatacggcctttcgtggatttggcttcccacaaggagcccaagtaacagaa
tcttgcatcacagctatggcagccaaatgtggccttccaccagaaaagattagagagaaa
aatatgtacaaaacagttgacaaaaccatctacaaacaagcattcaaccctgagaccctg
ataagatgttggaatgaatgtctggacaagtcttccttttacagcagaagaatgcacgtc
gaagagttcaataagaagaattattggaagaagaaaggcattgctattattcccatgaag
ttttcagttggctttgctgcaacaagctatcatcaggcagctgcactggttcatatctac
acagatgggtctgtgttggtcactcatggaggcaatgaactgggacaaggtattcacacc
aaaatgctgcaggtggccagccgtgagttaaaaatacccatgtcctgtatgcacatctct
gaaacgagcacagcaacagtacctaatacaattgctacagcagcgtctatcagtgcagat
gtcaatggcagagctgtgcagaatgcttgtcagatccttctgaaacgccttgagcccatc
attaagaaacatccggaaggtacatgggaagactggatagaagctgcatttgaacaaaga
atcagtctctcagccactggatacttcaggggctacaaggccttcatggactgggagaag
agggtgggggacccatttccttactatgtctatggagctgcctgttctgaggttgaaatc
gactgcctgacaggtgctcacaagaaaatcagaacggacatcatcatggatgcatgttgc
agcctaaatccggccattgatattggacagattgaaggttcgtttattcagggaatgggg
ctttataccactgaagaactgaaatactccccagaaggtgtcctgtactctcggagccca
gatgagtacaaaattccaaccatcactgatgccccagaggagttcaatgtctccttgctg
ccatcatcacaaaccccactaaccatctattcatctaagggcctcggggagtctgggatg
ttcctggggtcatctgtgttctttgccattgctgacgctgtggccacagtgtgaagagaa
agagacatagctgaggacttcatggtgcagagcccagcaacgccagaacgggttcgaatg
gcctgtgcagatcgattcacagaaatgatcccaagagatgaccctgagacatttaaacct
tcgtctatccctatagcgtaa

DBGET integrated database retrieval system