KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670705
Entry
104670705         CDS       T03989                                 

Gene name
AGT
Definition
(RefSeq) angiotensinogen
  KO
K09821  angiotensinogen
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04072  Phospholipase D signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04614  Renin-angiotensin system
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04931  Insulin resistance
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro05200  Pathways in cancer
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    104670705 (AGT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104670705 (AGT)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104670705 (AGT)
   04614 Renin-angiotensin system
    104670705 (AGT)
   04925 Aldosterone synthesis and secretion
    104670705 (AGT)
   04927 Cortisol synthesis and secretion
    104670705 (AGT)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104670705 (AGT)
   04270 Vascular smooth muscle contraction
    104670705 (AGT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670705 (AGT)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104670705 (AGT)
   05414 Dilated cardiomyopathy
    104670705 (AGT)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104670705 (AGT)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104670705 (AGT)
   04934 Cushing syndrome
    104670705 (AGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104670705 (AGT)
Peptidases and inhibitors [BR:rro01002]
 Peptidase inhibitors
  Family I4: serpin family
   104670705 (AGT)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 104670705
NCBI-ProteinID: XP_010372343
LinkDB
Position
8
AA seq 476 aa
MAPASVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFTP
VPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVH
GATILSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDENCTSRLDAHKVLSALQAVQG
LLVAQGRADGQGQLLLSMVVGLFTAPDLHLKQPFVQGLALYAPVVLPRSLDFTDLEVAAE
KIDRFMQAVTGWKISSPLTGASADSTVVFNTYVHFQGKMKDFSLLAEPQEFWVDNSTSVS
VPMLSGVGTFQHWSDSQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWM
KKLSPRAIRLTMPRLVLRGSYDLQDLLAQAELPAILGTELNLQKLSTDNLRVGKVLNSIF
FELEAAEREPTESTRQLNRPEVLEVTLDHPFLFAVYDQSATALHFLGRVANPLSPA
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggctcctgccagcgtgagcctgagggccaccatcctctgcctcctggcctgggctggc
ctggccgcaggtgaccgggtgtacatacaccccttccacctcgtcatccacaatgagagt
acctgtgagcagctggcaaaggccaatgctgggaagcccaaagatcccaccttcacacct
gttccgatacaggccaagacgtcccctgtggatgaaaaggccttgcaggaccagctagtg
ctggtcgctgcaaaactcgacaccgaggacaagttgagggccgcgatggtcgggatgctg
gccaacttcttgggcttccgcatatatggcatgcacagtgagctatggggcgtggtccat
ggggccaccatcctctccccaacggctgtctttggcaccctggcctctctctacctggga
gccttggaccacacagccgacaggctacaggcaatcctgggcgtcccttggaaggacgag
aactgcacctcccgcctggatgcgcacaaggtcctctctgccctgcaggctgtacagggc
ctgctggtggcccagggcagggctgatggccagggccagctgctgttgtccatggtggtg
ggcctattcacagccccagatctgcacctgaagcagccgtttgtgcagggcctggctctc
tatgcccctgtggtcctcccacgctctctggacttcacagacctggaagtcgctgctgag
aagattgacaggttcatgcaggctgtgacaggatggaagattagcagccccctgacggga
gccagtgcggacagcaccgtggtttttaacacctacgtccatttccaagggaagatgaag
gacttctccctgctggctgagccccaggagttctgggtggacaacagcacctcagtgtct
gtccccatgctgtctggcgtgggcaccttccagcactggagcgactcccaggacaacttc
tcggtgactcaagtgcccttcactgagagtgcttgcttgctgctgattcagcctcactat
gcttctgacctggacaaggtggagggcctcactttccagcaaaactccctcaactggatg
aagaaactgtctccccgggccatccgcctgaccatgccccgactggtgctgcgaggatct
tatgacctgcaggacctgcttgcccaggctgagctgcccgccattctgggcaccgagctg
aacctgcaaaaactgagcactgacaacctcagggtggggaaggtgctgaacagcattttt
tttgaactcgaagcggctgagagagagcccacagagtctacccgacagctgaacaggcct
gaggtcttggaggtgaccctggaccacccattcctgtttgctgtgtatgatcaaagcgcc
actgccctgcacttcctgggccgcgtggccaacccattgagcccagcatga

DBGET integrated database retrieval system