KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104670934
Entry
104670934         CDS       T03989                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04310  Wnt signaling pathway
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04670  Leukocyte transendothelial migration
rro04916  Melanogenesis
rro04919  Thyroid hormone signaling pathway
rro04934  Cushing syndrome
rro05010  Alzheimer disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05160  Hepatitis C
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05210  Colorectal cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05216  Thyroid cancer
rro05217  Basal cell carcinoma
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104670934 (CTNNB1)
   04310 Wnt signaling pathway
    104670934 (CTNNB1)
   04390 Hippo signaling pathway
    104670934 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104670934 (CTNNB1)
   04520 Adherens junction
    104670934 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    104670934 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    104670934 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104670934 (CTNNB1)
   04916 Melanogenesis
    104670934 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104670934 (CTNNB1)
   05205 Proteoglycans in cancer
    104670934 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104670934 (CTNNB1)
   05225 Hepatocellular carcinoma
    104670934 (CTNNB1)
   05226 Gastric cancer
    104670934 (CTNNB1)
   05216 Thyroid cancer
    104670934 (CTNNB1)
   05217 Basal cell carcinoma
    104670934 (CTNNB1)
   05215 Prostate cancer
    104670934 (CTNNB1)
   05213 Endometrial cancer
    104670934 (CTNNB1)
   05224 Breast cancer
    104670934 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104670934 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    104670934 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104670934 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104670934 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104670934 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104670934 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    104670934 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104670934 (CTNNB1)
   05163 Human cytomegalovirus infection
    104670934 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104670934 (CTNNB1)
   05165 Human papillomavirus infection
    104670934 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 104670934
NCBI-ProteinID: XP_010372596
UniProt: A0A2K6QNF6
LinkDB
Position
1
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggagttggacatggccatggaaccagacagaaaagcg
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcctgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatctacacagtttgatgctgctcatcccact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aatgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgctatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgatgtagaaacagctcgttgtaccgctgggaccttgcataac
ctttcccatcatcgggagggcttgctggccatctttaagtctggaggcattcctgccctg
gtgaaaatgcttggttcaccagtggattctgtgttgttttatgccattacaactctccac
aaccttttattacatcaagaaggagctaaaatggcagtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaacgttaaattcttggctattacgacagactgc
cttcaaattttagcatatggcaaccaagaaagcaagctgatcatactggctagtggtgga
ccccaagctttagtaaatataatgaggacctatacttatgagaaactactgtggaccaca
agcagagtgctgaaggtgctatccgtctgctctagtaataagccagctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaac
tgtctttggactctcaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgggctggtgacagggaagacatc
actgagcctgccatctgtgctcttcgtcatttgaccagccgacaccaagaagcagagatg
gcccagaatgcagttcgccttcactatggactaccagttgtggtcaagctcttacaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgtgagcagggtgccattccacgactagttcagttgctt
gttcgtgcacatcaggatacccagcgccgtacgtccatgggtgggacacagcagcaattt
gtggagggggtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaattgtaatcagaggactaaacaccattccattgtttgtg
cagctgctttattctcccattgaaaacatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagctgagggagccacagctcctctg
acagagttacttcactctaggaatgaaggtgtggcgacgtatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaagattacaagaaacggctttcagttgagctgaccagc
tctctcttcagaacggagccaatggcttggaatgagactgcggatcttggacttgatatt
ggtgcccagggagaaccccttggatatcgccaggatgatcctagctatcgttcttttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggaacatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgatagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system