KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671116
Entry
104671116         CDS       T03989                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box protein O1 isoform X2
  KO
K07201  forkhead box protein O1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04213  Longevity regulating pathway - multiple species
rro04218  Cellular senescence
rro04910  Insulin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro04922  Glucagon signaling pathway
rro04931  Insulin resistance
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05165  Human papillomavirus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104671116 (FOXO1)
   04152 AMPK signaling pathway
    104671116 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104671116 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104671116 (FOXO1)
   04922 Glucagon signaling pathway
    104671116 (FOXO1)
   04919 Thyroid hormone signaling pathway
    104671116 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    104671116 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    104671116 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671116 (FOXO1)
   05202 Transcriptional misregulation in cancer
    104671116 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    104671116 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    104671116 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    104671116 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    104671116 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104671116 (FOXO1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    104671116 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 104671116
NCBI-ProteinID: XP_010372824
LinkDB
Position
18
AA seq 655 aa
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGGATANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAVPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPMQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPNSHTHPGHAQQSSAVNGRALS
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSMSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggccgaggcgcctcaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccaactcggccacctcc
agcccggcgccgtcgggcggcgcgactgccaaccccgacgccgcggcgggcctgccctcg
gcctcggctgccgctgtcagcgccgacttcatgagcaacctgagcttgctggaggagagc
gaggactttccgcaggcacccggctctgtggcggcggcggtggcggcggcggccgccgcg
gccgccaccgggggactgtgcggggacttccagggcccggaggcgggctgcctgcaccca
gcgccgccacagcccccgccgccggggccgctgtcgcagcacccgccagtgccccccgcc
gccgccgtgcctctcgcggggcagccgcgcaagagcagctcgtcccgccgcaacgcgtgg
ggcaacctgtcctacgctgacctcatcaccaaggctatcgagagctcggcggagaagcgg
ctgacgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttcaaggataag
ggtgacagcaacagctcggcgggctggaagaattcaattcgtcataatctgtccctacac
agcaagttcattcgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaat
ccagagggcggcaagagcgggaaatctcccaggagaagagccgcatccatggacaacaac
agtaaatttgctaagagccgaagccgagctgccaagaagaaagcatccctccagtctggc
caggagggtgctggggacagccctggatcacagttttccaagtggcctgcaagccctggc
tctcatagcaacgacgactttgataactggagtacatttcgccctcgaactagctcaaat
gctagtactattagtgggagactctcacccattatgaccgaacaggatgatcttggagaa
ggggatgtgcattctatggtgtacccgccatctgccgcaaagatggcctctactttaccc
agtctgtctgagataagcaatcccgaaaacatggaaaatcttttggataatctcaacctt
ctctcatcaccaacatcattaactgtttcgacccagtcctcacctggcaccatgatgcag
cagacaccatgctactcgtttgcgccaccaaacaccagtttgaattcacccagcccaaac
taccaaaaatatacatatggccaatccagcatgagccctttaccccagatgcctatgcaa
acacttcaggacaataagtcaagttatggagggatgagtcagtataactgtgcacctgga
ctcttgaaggagttgctgacttctgactctcctccccacaatgacattatgacaccagtt
gatcctggggtagctcaacccaacagccgggttctgggccagaacgtcatgatgggccct
aattcggtcatgtcaacctatggcagccaggcatctcataacaaaatgatgaatcccaac
tcccatacccaccctggacacgctcagcagtcatctgcagttaatgggcgtgccctgtcc
cacacggtaagcaccatgccccacacctcgggaatgaaccgcctgacccaagtgaagaca
cctgtacaagtgcctctgccccaccccatgcagatgagtgccctggggggctactcctcc
atgagcagctgcaatggctatggcagaatgggccttctccaccaggagaagctcccaagt
gacttggatggcatgttcattgagcgcttagactgtgacatggaatccatcattcggaat
gacctcatggatggagatacattggattttaattttgacaatgtgttgcccaaccaaagt
ttcccgcacagtgtcaagacgacgacacatagctgggtgtcaggctga

DBGET integrated database retrieval system