KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671550
Entry
104671550         CDS       T03989                                 

Gene name
AGTR1
Definition
(RefSeq) type-1 angiotensin II receptor
  KO
K04166  angiotensin II receptor type 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04072  Phospholipase D signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04261  Adrenergic signaling in cardiomyocytes
rro04270  Vascular smooth muscle contraction
rro04371  Apelin signaling pathway
rro04614  Renin-angiotensin system
rro04924  Renin secretion
rro04925  Aldosterone synthesis and secretion
rro04927  Cortisol synthesis and secretion
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04934  Cushing syndrome
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104671550 (AGTR1)
   04020 Calcium signaling pathway
    104671550 (AGTR1)
   04072 Phospholipase D signaling pathway
    104671550 (AGTR1)
   04022 cGMP-PKG signaling pathway
    104671550 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104671550 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104671550 (AGTR1)
   04614 Renin-angiotensin system
    104671550 (AGTR1)
   04925 Aldosterone synthesis and secretion
    104671550 (AGTR1)
   04927 Cortisol synthesis and secretion
    104671550 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104671550 (AGTR1)
   04270 Vascular smooth muscle contraction
    104671550 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671550 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104671550 (AGTR1)
   04934 Cushing syndrome
    104671550 (AGTR1)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104671550 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104671550 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104671550 (AGTR1)
Membrane trafficking [BR:rro04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    104671550 (AGTR1)
G protein-coupled receptors [BR:rro04030]
 Rhodopsin family
  Peptide
   Angiotensin
    104671550 (AGTR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 104671550
NCBI-ProteinID: XP_010373354
LinkDB
Position
1
AA seq 359 aa
MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIVIWLLAGLASLPAIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNASSSTKKPAPCFEVE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgattctcaactcatctaccgaagatggtattaaaagaatccaagacgattgtcccaaa
gctggaaggcataattacatatttgtcatgattcctactttatacagtatcatctttgtg
gtgggaatatttggaaacagcttggtggtgatagtcatttacttttacatgaagctgaag
actgtggccagtgtttttcttttgaatttagcactggctgacttatgctttttactgact
ttgccactatgggctgtctacacagctatggaataccgctggcccttcggcaattacctg
tgtaagattgcttcagccagcgtcagtttcaacctgtatgctagtgtgtttctcctcacg
tgtctcagcattgatcgatacctggctattgttcacccaatgaagtcccgccttcgacgc
acaatgcttgtagccaaagtcacctgcattgtcatttggctgctggcaggcttggccagt
ttgccagctatcatccatcgaaatgtatttttcattgagaacaccaatattacagtttgt
gctttccattatgagtcccaaaattcaaccctcccgataggactgggcctgaccaaaaat
atactgggtttcctgtttccttttctgatcattcttacaagttatactcttatttggaag
gccctaaagaaggcttatgaaattcagaagaacaaaccaagaaatgatgatatttttaag
ataattatggcaattgtgcttttctttttcttttcctggattccccaccaaatattcact
tttctggatgtattaattcaactaggcatcatacgtgactgtagaattgcagatattgtg
gacacagccatgcccatcaccatttgtatagcttattttaacaattgcctgaatcctctt
ttttatggctttctggggaaaaaatttaaaaaatattttctccagcttctaaaatacatt
cccccaaaagccaaatcccactcaaacctttcaacaaaaatgagcacgctttcctaccgc
ccctcagataatgcaagctcatccacgaagaagcctgcaccatgttttgaggttgagtga

DBGET integrated database retrieval system