KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671624
Entry
104671624         CDS       T03989                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04020  Calcium signaling pathway
rro04062  Chemokine signaling pathway
rro04064  NF-kappa B signaling pathway
rro04066  HIF-1 signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04072  Phospholipase D signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04380  Osteoclast differentiation
rro04611  Platelet activation
rro04613  Neutrophil extracellular trap formation
rro04625  C-type lectin receptor signaling pathway
rro04650  Natural killer cell mediated cytotoxicity
rro04662  B cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04750  Inflammatory mediator regulation of TRP channels
rro04919  Thyroid hormone signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
Module
rro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104671624 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104671624 (PLCG2)
   04014 Ras signaling pathway
    104671624 (PLCG2)
   04370 VEGF signaling pathway
    104671624 (PLCG2)
   04064 NF-kappa B signaling pathway
    104671624 (PLCG2)
   04066 HIF-1 signaling pathway
    104671624 (PLCG2)
   04020 Calcium signaling pathway
    104671624 (PLCG2)
   04070 Phosphatidylinositol signaling system
    104671624 (PLCG2)
   04072 Phospholipase D signaling pathway
    104671624 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104671624 (PLCG2)
   04613 Neutrophil extracellular trap formation
    104671624 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    104671624 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    104671624 (PLCG2)
   04662 B cell receptor signaling pathway
    104671624 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    104671624 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    104671624 (PLCG2)
   04670 Leukocyte transendothelial migration
    104671624 (PLCG2)
   04062 Chemokine signaling pathway
    104671624 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104671624 (PLCG2)
   04919 Thyroid hormone signaling pathway
    104671624 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104671624 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104671624 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    104671624 (PLCG2)
   04380 Osteoclast differentiation
    104671624 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104671624 (PLCG2)
   05206 MicroRNAs in cancer
    104671624 (PLCG2)
   05205 Proteoglycans in cancer
    104671624 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104671624 (PLCG2)
   05214 Glioma
    104671624 (PLCG2)
   05223 Non-small cell lung cancer
    104671624 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104671624 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104671624 (PLCG2)
   05171 Coronavirus disease - COVID-19
    104671624 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104671624 (PLCG2)
   05169 Epstein-Barr virus infection
    104671624 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104671624 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104671624 (PLCG2)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104671624 (PLCG2)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104671624 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104671624 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 104671624
NCBI-ProteinID: XP_010373447
UniProt: A0A2K6RT65
LinkDB
Position
20
AA seq 1265 aa
MSTMVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAL
NWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLSKVRERMTKFIDDTMRETAEPFLFVDEFLMYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKT
FKEVFGDLLLMKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNVEDKKDEQKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTTEEEGPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTTEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYESLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADVEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSISRQKPVDLLRYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKF
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGADYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQLYQEKCNKRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgtccactatggtcaatgtggattcccttgcggaatatgagaagagccagatcaagaga
gccctggagctggggacggtgatgactgtgttcagcttccgcaagtccacccctgagcgg
aggaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagaccgctgacaag
atcgagggcttcttggatatcatggaaataaaagaaatccgcccagggaagaactccaaa
gattttgaacgtgcaaaagcagttcgccagaaagaagattgctgcttcaccatcctgtat
ggcactcagttcgtcctcagcacactcagcttggcagctgactctaaagaagacgcactt
aattggctctctggcttgaaaatcttacaccaagaagcgatgagtgcgtccacacccacc
attatcgagagttggctgagaaagcagatatattctgtggatcaaaccagaagaaacagc
atcagtctccgagagttgaagaccatcttgcccctgatcaactttaaagtgagcagtgcc
aagttccttaaagataagtttgtggaaataggagcacacaaagatgagctcagctttgaa
cagttccatctcttctataaaaaacttatgtttgagcagcaaaaatcgattctcgatgaa
ttcaaaaaggattcgtccgtgttcatcctggggaacactgacaggccggatgcctccgct
gtttacctgcatgacttccagaggtttctcatacatgaacagcaggagcattgggctcag
gatctgagcaaagtccgtgagcggatgacaaagttcatcgatgacaccatgcgtgaaact
gctgagcctttcttgtttgtggatgagttcctcatgtacctgttttcacgagaaaacagc
atctgggatgagaagtatgacgtggtggacatgcaggacatgaacaaccccttgtctcat
tactggatctcctcgtcacataacacgtacctcacaggtgaccagctgcggagcgagtcg
tccccggaagcttacatccgctgcctgcgcatgggctgtcgctgcattgaactggactgc
tgggacgggcctgatgggaagccggtcatctaccacggctggacgcggaccaccaagatc
aagtttgatgacgtcgtacaggccatcaaagaccacgcctttgttacctcaagcttccca
gtgatcctgtccatcgaggagcactgcagcgtggagcagcagcgtcacatggccaagacc
ttcaaggaagtgtttggcgacctgctgctgatgaagcccacggaggccagcgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcacaagaagctgggtccc
cgaggcgacgtggatgtcaacgtggaggacaagaaggatgagcagaagcaacagggagag
ctgtacatgtgggattccatcgaccagaaatggactcggcactactgcgccattgccgac
gccaagctgtccttcagtgatgacattgaacagactacggaggaggaagggccccaggat
ataccccctacagagctacattttggggagaaatggttccacaagaaggtggagaagagg
acgagtgccgagaagttgctgcaggaatactgcatggagacagggggcaaggacggcacc
ttcctggttcgggagagcgagaccttccccaatgactacaccctgtccttctggcggtca
ggccgggtccagcactgccggatccgttccaccacggagggtggaaccctgaagtactac
ctgactgacaacctcaccttcagcagcatctacgccctcatccagcactaccgcgagacg
cacctgcgctgcgccgagtttgagttgcggctcacggaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactatgagagcctgagccgcggagaggcagaggacatgctg
atgaggatcccccgggacggagccttcctgatccggaagcgagagggaagcgactcctat
gccatcaccttcagggctaggggcaaggtgaagcattgtcgcatcaaccgggatggccgg
cactttgtgctggggacctctgcctattttgagagtctggtggagctcgtcagttactac
gagaagcattcactctaccgaaagatgagactgcgctatcccgtgacccccgagctcctg
gagcgctacaacatggaaagagatataaactccctctacgatgtcagcagaatgtatgtg
gatcccagtgaaatcaatccgtccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcaaagcgatgagctgagcttctgccgcggtgccctcatccacaatgtctcc
aaggagcccgggggctggtggaaaggagactatggaaccaggatccagcagtacttccca
tccaactacgtcgaggacatctcaactgcagatgttgaggagctggaaaaacagattatt
gaagacaatcccttagggtctctttgcagaggaatattggacctcaacacctataacgtc
gtgaaagccccacagggaaaaaaccagaagccctttgtctttatcctggagcccaagaag
cagggcgaccctccggtggagtttgccacagacagggtggaggagctcttcgagtggttt
cagagcatccgagagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctctgatctggtggtctactgcaaaccaacc
agcaaaaccaaggacaacttagaaaatcctgacttccgagaaatccgctcctttgtggag
acgaaggctgacagcatcagcaggcagaagcccgtcgacctcctgaggtacaatcaaaag
ggcctgacccgcgtctacccaaagggacaaagagttgactcttcaaactacgaccccttc
cgcctctggctgtgcggttctcagatggtggcactcaatttccagacggcagataagttc
atgcagatgaatcacgcgctgttttctctcaatgggcgcacgggctacgttctgcagcct
gagagcatgaggacagagaaatatgacccaatgccacccgagtcccagaggaagatcctg
atgacgctgacggtcaaggttctcggtgctcgccatctccccaaacttggacgaagtatt
gcctgtccctttgtagaggtagagatctgtggcgccgactatgacaacaacaagttcaag
acgacggttgtgaatgataatggcctcagccctatctgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaacctggcatttctgcgctttgtggtttacgaagaagat
atgttcagtgatcccaactttcttgctcatgccacttaccccattaaagcaatcaaatca
ggattcaggtctgttcctctgaagaatgggtacagcgaggacatagagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggaactttactcctcctgt
cgccagctaaggaggcggcaagaagaactgaacaaccagctctttctgtatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggttaaagagttcaatgttaatgagaac
cagctccagctgtaccaggagaaatgcaacaagaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672220
Entry
104672220         CDS       T03989                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00562  Inositol phosphate metabolism
rro01100  Metabolic pathways
rro01521  EGFR tyrosine kinase inhibitor resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04062  Chemokine signaling pathway
rro04064  NF-kappa B signaling pathway
rro04066  HIF-1 signaling pathway
rro04070  Phosphatidylinositol signaling system
rro04072  Phospholipase D signaling pathway
rro04360  Axon guidance
rro04370  VEGF signaling pathway
rro04613  Neutrophil extracellular trap formation
rro04650  Natural killer cell mediated cytotoxicity
rro04658  Th1 and Th2 cell differentiation
rro04659  Th17 cell differentiation
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04666  Fc gamma R-mediated phagocytosis
rro04670  Leukocyte transendothelial migration
rro04722  Neurotrophin signaling pathway
rro04750  Inflammatory mediator regulation of TRP channels
rro04919  Thyroid hormone signaling pathway
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro04935  Growth hormone synthesis, secretion and action
rro05012  Parkinson disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05135  Yersinia infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05170  Human immunodeficiency virus 1 infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05214  Glioma
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
rro_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104672220 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104672220 (PLCG1)
   04014 Ras signaling pathway
    104672220 (PLCG1)
   04015 Rap1 signaling pathway
    104672220 (PLCG1)
   04370 VEGF signaling pathway
    104672220 (PLCG1)
   04064 NF-kappa B signaling pathway
    104672220 (PLCG1)
   04066 HIF-1 signaling pathway
    104672220 (PLCG1)
   04020 Calcium signaling pathway
    104672220 (PLCG1)
   04070 Phosphatidylinositol signaling system
    104672220 (PLCG1)
   04072 Phospholipase D signaling pathway
    104672220 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    104672220 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    104672220 (PLCG1)
   04660 T cell receptor signaling pathway
    104672220 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    104672220 (PLCG1)
   04659 Th17 cell differentiation
    104672220 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    104672220 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    104672220 (PLCG1)
   04670 Leukocyte transendothelial migration
    104672220 (PLCG1)
   04062 Chemokine signaling pathway
    104672220 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    104672220 (PLCG1)
   04919 Thyroid hormone signaling pathway
    104672220 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104672220 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    104672220 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    104672220 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672220 (PLCG1)
   05206 MicroRNAs in cancer
    104672220 (PLCG1)
   05205 Proteoglycans in cancer
    104672220 (PLCG1)
   05231 Choline metabolism in cancer
    104672220 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104672220 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104672220 (PLCG1)
   05214 Glioma
    104672220 (PLCG1)
   05223 Non-small cell lung cancer
    104672220 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    104672220 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    104672220 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104672220 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    104672220 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104672220 (PLCG1)
   05171 Coronavirus disease - COVID-19
    104672220 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104672220 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104672220 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104672220 (PLCG1)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     104672220 (PLCG1)
Membrane trafficking [BR:rro04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    104672220 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    104672220 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 104672220
NCBI-ProteinID: XP_010374254
UniProt: A0A2K6Q7Y9
LinkDB
Position
13
AA seq 1291 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLQTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISVEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATYPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKQENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFED
FRISQEHLADHFDSRERRAPRRTRVNGDNRL
NT seq 3876 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatagagggggccattgatattcgtgaaatcaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggaccccgctttccgg
ccggaccagtcacactgctttgtcattctctatggaatggaattccgcctgaagacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatactttgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctaaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttgcgagagatcgaggagccatacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaatagtgtgtggaactcgcagctggatgcagtatgcccggac
accatgaacaaccccctttcccactattggatctcttcctcacacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccagatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcaaaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccagcacttcaagaaggtgctaggggacacactcctcaccaag
cccgtggagatctccgctgatgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggcggagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactccatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactacttcgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcggcacatcgctgagcgcctgctcactgagtactgcatcgagaccggggcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaatgggaaagtccagcactgccgtatccactcacggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacacactaccag
caggtgcctctgcgctgcaatgagtttgagatgcgactttcagagcctgtcccacagacg
aatgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctgatgcgtgtccctcgtgatggggccttcctggtgcggaagcggaatgagcccaac
tcatatgccatctctttccgggctgaaggcaagatcaagcattgccgtgtccagcaagag
ggccagactgtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaagcacccgctataccgcaagatgaaactgcgctatcccatcaacgaggaggcg
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagctctcttt
gactacaaggcccagagagaggatgagctgaccttcaccaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccagagagggag
cacttggacgagaacagccccctaggggacttgctgcggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgctgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagaccgcagatgccaggctcactgaaggg
aagataatggaacggaggaagaagatcgccctggagctctctgaacttgttgtctactgc
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagctggtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggctctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctgttgaggtgctgggtgccagacatttg
ccaaagaatggccgaggcattgtgtgcccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtggtggacaatggactcaaccctgtatgg
ccggccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaatttcctggctcaggctacttacccggta
aaaggcctgaagacaggatacagagcagtgcctttgaagaacaactacagtgaggacctg
gagttggcctccctgctgatcaagattgacattttccctgccaagcaggagaatggtgac
ctcagtcccttcagtggtacgtccctgcgggagcggggctcagatgcctcaggccagctg
tttcacggccgagcccgggaaggctcctttgaatcccgctaccagcagccatttgaggac
ttccgcatctcccaggagcatcttgcagaccattttgacagtcgagaacgaagggcccca
agaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system