KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104671929
Entry
104671929         CDS       T03989                                 

Gene name
PTPN2
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X1
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    104671929 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rro01009]
    104671929 (PTPN2)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     104671929 (PTPN2)
Protein phosphatases and associated proteins [BR:rro01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    104671929 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc LAP1C Synaptobrevin CHASE3 Y_phosphatase3 IKKbetaNEMObind
Other DBs
NCBI-GeneID: 104671929
NCBI-ProteinID: XP_030781646
LinkDB
Position
21
AA seq 438 aa
MPTTIEREFEELDTQRRWQSLYLEIRNESHDYPHRVAKIPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINYIENLWITLYLKLLM
LDVKRSLKSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCS
AGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAK
CIKGDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKM
QDTMEENSESALRKRIREDRKATTAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFVSV
ILVGAFVGWTLFFQQNAL
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcccaccaccatcgagcgggagttcgaggagttggatactcagcgtcgctggcagtcg
ctgtacttggaaattcgaaatgagtcccatgactatcctcatagagtggccaagattcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagccgtgttaaa
ctgcagaatgctgagaatgattatattaacgccagtttagttgacatagaagaggcacaa
aggagttacatcttaacacagggtccacttcctaacacatgctgccatttctggcttatg
gtttggcagcagaagaccaaagcagttgtcatgctgaaccgcattgtggagaaagaatcg
gttaaatgtgcacagtactggccaacagatgaccaagagatgctgtttaaagaaacagga
ttcagtgtgaagctcttgtcagaagatgtgaagtcgtattatacagtacatctactacaa
ttagaaaatatcaattatattgagaacttgtggatcacactgtatttgaaattattaatg
ctggatgttaaaaggtcactaaaaagtggtgaaaccagaacaatatctcactttcattat
actacctggccagattttggagtccctgaatcaccagcttcatttctcaatttcttgttt
aaagtgagagaatctggctccttgaaccctgaccatgggcctgcggtgatccactgtagt
gcaggcattggacgctctggcaccttctctctggtagacacttgtcttgttttgatggaa
aaaggagatgatattaacattaaacaagtgttactcaacatgagaaaatacagaatgggt
cttattcagaccccagatcaactgagattctcatacatggctataatagaaggagcaaaa
tgtataaagggagattctagtatacagaaacgatggaaagaactttctaaggaagactta
tctcctgcctttgatcattcaccaaacaaaataatgactgaaaaatacaatgggaacaga
ataggtctagaagaagaaaaactgacaggtgaccgatgtacaggactttcctctaaaatg
caagatacaatggaggagaacagtgagagtgctctacggaaacgtattcgagaggacagg
aaggccaccacagctcagaaggtgcagcagatgaaacagaggctaaatgagaatgaacga
aaaagaaaaaggtggttatattggcaacctattctcactaagatggggtttgtgtcagtc
attttggttggcgcttttgttggctggacactgttttttcagcaaaatgccctataa

DBGET integrated database retrieval system