KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672054
Entry
104672054         CDS       T03989                                 

Gene name
NRG4
Definition
(RefSeq) pro-neuregulin-4, membrane-bound isoform
  KO
K05458  neuregulin 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104672054 (NRG4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104672054 (NRG4)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104672054 (NRG4)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 104672054
NCBI-ProteinID: XP_030785901
LinkDB
Position
5
AA seq 117 aa
MPTDHEEPCGPSHKSFCLNGGLCYMIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKNN
LFEAFMALAVLVTLIIGAFYFLCSVRKGHFQRASSVQYDINLVETSSTSAHHNHGEH
NT seq 354 nt   +upstreamnt  +downstreamnt
atgccaacagatcacgaagagccctgtggtcccagtcacaagtcattttgcctgaatggg
gggctttgttatatgatacctactattcccagcccattttgtaggtgtattgaaaactac
acaggagctcgttgtgaagaggtttttctcccaagctccagcatccaaactaaaaataac
ctgtttgaagctttcatggcattggcagtcctagtaacacttatcattggagccttctac
ttcctttgcagtgtcaggaagggccactttcagagagccagttcagtccagtatgatatc
aacctggtagagacgagcagtaccagtgcccaccacaatcatggagaacactga

DBGET integrated database retrieval system