KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672345
Entry
104672345         CDS       T03989                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X2
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04620  Toll-like receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04912  GnRH signaling pathway
rro04926  Relaxin signaling pathway
rro04935  Growth hormone synthesis, secretion and action
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05142  Chagas disease
rro05161  Hepatitis B
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104672345 (MAP2K4)
   04012 ErbB signaling pathway
    104672345 (MAP2K4)
   04668 TNF signaling pathway
    104672345 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104672345 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    104672345 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104672345 (MAP2K4)
   04926 Relaxin signaling pathway
    104672345 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    104672345 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104672345 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104672345 (MAP2K4)
   05135 Yersinia infection
    104672345 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104672345 (MAP2K4)
   05161 Hepatitis B
    104672345 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104672345 (MAP2K4)
   05169 Epstein-Barr virus infection
    104672345 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    104672345 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104672345 (MAP2K4)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     104672345 (MAP2K4)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE7 family
   104672345 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 104672345
NCBI-ProteinID: XP_010374430
UniProt: A0A2K6PJ85
LinkDB
Position
19
AA seq 399 aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
ccgggccccgtagggtccccggcgccgggccacccggccgtcagcagcatgcagggtaaa
cgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggtttact
ctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacacagc
attgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagag
gacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtc
cacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaa
gaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatac
attgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactc
atgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttatt
ccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaa
gaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacagaagt
gggaatattaaactctgtgactttggcatcagtggacagcttgtggactctattgccaag
acaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagcgcatca
cgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtatgagttg
gccacaggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtc
gtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccaagtttc
atcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagag
cttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgcatgctat
gtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgattga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104679497
Entry
104679497         CDS       T03989                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04141  Protein processing in endoplasmic reticulum
rro04380  Osteoclast differentiation
rro04530  Tight junction
rro04620  Toll-like receptor signaling pathway
rro04660  T cell receptor signaling pathway
rro04664  Fc epsilon RI signaling pathway
rro04668  TNF signaling pathway
rro04722  Neurotrophin signaling pathway
rro04912  GnRH signaling pathway
rro04926  Relaxin signaling pathway
rro05010  Alzheimer disease
rro05016  Huntington disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05161  Hepatitis B
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05170  Human immunodeficiency virus 1 infection
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104679497 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104679497 (MAP2K7)
   04012 ErbB signaling pathway
    104679497 (MAP2K7)
   04668 TNF signaling pathway
    104679497 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104679497 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104679497 (MAP2K7)
   04660 T cell receptor signaling pathway
    104679497 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    104679497 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    104679497 (MAP2K7)
   04926 Relaxin signaling pathway
    104679497 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104679497 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104679497 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104679497 (MAP2K7)
   05016 Huntington disease
    104679497 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    104679497 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104679497 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104679497 (MAP2K7)
   05135 Yersinia infection
    104679497 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104679497 (MAP2K7)
   05161 Hepatitis B
    104679497 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104679497 (MAP2K7)
   05169 Epstein-Barr virus infection
    104679497 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104679497 (MAP2K7)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     104679497 (MAP2K7)
Protein kinases [BR:rro01001]
 Serine/threonine kinases: STE group
  STE7 family
   104679497 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 104679497
NCBI-ProteinID: XP_030792019
LinkDB
Position
8
AA seq 435 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESP
RTSGVLSQPHLPFFR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccagcgagcagccctgcag
ctcccgctggccaatgatgggggcagccgttcgccatcctcagagagctccccgcagcac
cccacgccccccgcccggccccgccacatgctggggctcccgtcaaccctgttcacaccc
cgaagcatggagagcattgagattgaccagaagctgcaggagatcatgaagcagacgggc
tacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctggagaacttgggc
gagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccggaagaccggccac
gtcattgccgttaagcaaatgcggcgctcggggaacaaggaggagaacaagcgtatcctc
atggacctggatgtggtgctcaagagccatgactgcccctacattgtgcagtgctttggg
acgtttatcaccaacacggacgtcttcatcgccatggagctcatgggcacctgcgccgag
aaactcaagaagcggatgcagggccccatccccgagcgcatcctgggcaagatgacagtg
gcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatccaccgcgacgtc
aagccctccaatatcctgctggacgagcggggccagatcaagctctgcgacttcggcatc
agtggccgcctggtggactccaaagccaagacgcggagcgccggctgcgcagcctacatg
gcgcccgagcgcattgaccccccagaccccaccaagccagactatgacatccgggctgat
gtatggagcctaggcatctcgttggtggagctggcaacaggacagtttccctacaagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagagcccccgcttctgccc
ggacacatgggcttctcgggggacttccagtccttcgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcgctatgag
acgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaagactgagtcaccg
cggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

DBGET integrated database retrieval system