KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672529
Entry
104672529         CDS       T03989                                 

Gene name
NRG3
Definition
(RefSeq) pro-neuregulin-3, membrane-bound isoform isoform X1
  KO
K05457  neuregulin 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
rro05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104672529 (NRG3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    104672529 (NRG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104672529 (NRG3)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104672529 (NRG3)
SSDB
Motif
Pfam: EGF Laminin_EGF EGF_2 LapA_dom
Other DBs
NCBI-GeneID: 104672529
NCBI-ProteinID: XP_030797283
LinkDB
Position
11
AA seq 720 aa
MSEGAAAASPPGAASAAAASTEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
STTARNTAAPSTVLSTTAPFFSSSTPGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTP
SWTLSPFQDAASSSSSSSSSSTTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQ
VLSISCIIFGIVIVGMFCAALYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV
KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPG
QRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGIEVRKTISHLPI
QLWCVERPLDLKYSSNGLKTQRNTSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPI
IPSVGLEETCLQMPGISEVKSIKWCKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQE
QIRILTDARRSEDYELASVETEDSASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgagtgaaggggcggccgctgcctcgccacctggtgccgcttcggcagccgccgcctcg
accgaggagggcaccgcggcggctgcggcggcggcagcggcgggcgggggcccggacggc
ggcggcgaaggggcggccgagcccccccgggagttacgctgtagcgactgcatcgtgtgg
aaccggcagcagacgtggctgtgcgtggtacctctgttcatcggcttcatcggcctgggg
ctcagcctcatgcttctcaaatggatcgtggtgggctccgtcaaggagtacgtgcccacc
gacctagtggactccaaggggatgggccaggaccccttcttcctctcgaagcccagctct
ttccccaaggccatggagaccaccaccactaccacctccaccacgtcccccgccaccccc
tccgccgggggtgccgcctcctccaggacgcccaaccggattagcactcgcctgaccacc
atcacgcgggcgcccactcgcttccccgggcaccgggtgcccatccgggccagcccgcgc
tctaccacagcacggaacactgcggccccctcgacggtcctgtccaccacggcaccgttc
tttagtagcagcacgccgggctcccgacccccggtgccaggaaccccaagtacccaggca
atgccctcctggcccactgcggcatacgctacctcctcctaccttcacgattctactccc
tcctggaccctgtctccctttcaggatgctgcctcctcttcttcctcttcttcctcctcc
tctaccaccaccacaccagaaactagcaccagccccaaatttcatactacgacatattcc
acagagcgatccgagcacttcaaaccctgccgagacaaggaccttgcatactgtctcaac
gatggcgagtgctttgtgatcgaaaccctgactggatcccataaacactgtcggtgcaaa
gaaggctaccaaggagtccgttgtgatcaatttctgccgaaaactgattccatcttatcg
gatccaacagaccacttggggattgaattcatggagagtgaagaagtttatcaaaggcag
gtgctgtcaatttcatgtatcatctttggaattgtcatcgtgggcatgttctgtgcagca
ttgtacttcaaaagcaagaaacaagctaaacaaatccaagagcagctgaaagtgccacaa
aatggtaaaagctacagtctcaaagcatccagcacaatggcaaagtcagagaacttggtg
aagagccatgtccagctgcaaaattattcaaaggtggaaaggcatcctgtgactgcattg
gagaaaatgatggagtcaagttttgtcggcccccagtcattccctgaagtcccttctcct
gacagaggaagccagtctgtcaaacaccacaggagtttatcctcttgctgcagcccaggg
caaaggagtggcatgctccataggaatgccttcagaaggacacccccgtcaccccgaagt
aggctaggcggaattgtgggaccagcatatcagcaactcgaagaatcaaggatcccagac
caggatacgataccttgccaagggatagaggtcaggaagactatatcccacctgcctata
cagctgtggtgtgttgaaagacccctggacttaaagtattcatccaatggtttaaaaact
caacgaaatacatcaataaatatgcaactgccttcaagagagacaaacccctattttaat
agcttggagcaaaaggacctggtgggctattcatccacaagggccagttctgtgcccatc
atcccttcagtgggtttagaggaaacctgcctgcaaatgccagggatttctgaagtcaaa
agcatcaaatggtgcaaaaactcctattcagctgacgttgtcaatgtgagtattccagtc
agcgattgtcttatagcagaacaacaagaagtgaaaatattgctagaaactgtccaggag
cagatccgaattctgactgatgccagacggtcagaagactacgaactggccagcgtagaa
accgaggacagtgcaagcgaaaacacagcctttctccccctgagtcccacggccaaatca
gaacgagaggcacaatttgtcttaagaaatgaaatacaaagagactctgcattgaccaag
tga

DBGET integrated database retrieval system