KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672769Help
Entry
104672769         CDS       T03989                                 

Definition
(RefSeq) actin, cytoplasmic 1
  KO
K05692  actin beta/gamma 1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04015  Rap1 signaling pathway
rro04145  Phagosome
rro04210  Apoptosis
rro04390  Hippo signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro04611  Platelet activation
rro04670  Leukocyte transendothelial migration
rro04714  Thermogenesis
rro04810  Regulation of actin cytoskeleton
rro04919  Thyroid hormone signaling pathway
rro04921  Oxytocin signaling pathway
rro05100  Bacterial invasion of epithelial cells
rro05132  Salmonella infection
rro05135  Yersinia infection
rro05164  Influenza A
rro05205  Proteoglycans in cancer
rro05225  Hepatocellular carcinoma
rro05410  Hypertrophic cardiomyopathy (HCM)
rro05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
rro05414  Dilated cardiomyopathy (DCM)
rro05416  Viral myocarditis
rro05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    104672769
   04390 Hippo signaling pathway
    104672769
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104672769
  09143 Cell growth and death
   04210 Apoptosis
    104672769
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104672769
   04520 Adherens junction
    104672769
   04530 Tight junction
    104672769
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104672769
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    104672769
   04670 Leukocyte transendothelial migration
    104672769
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    104672769
   04919 Thyroid hormone signaling pathway
    104672769
  09159 Environmental adaptation
   04714 Thermogenesis
    104672769
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    104672769
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104672769
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    104672769
   05410 Hypertrophic cardiomyopathy (HCM)
    104672769
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    104672769
   05414 Dilated cardiomyopathy (DCM)
    104672769
   05416 Viral myocarditis
    104672769
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104672769
   05135 Yersinia infection
    104672769
   05100 Bacterial invasion of epithelial cells
    104672769
  09172 Infectious disease: viral
   05164 Influenza A
    104672769
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rro03021]
    104672769
   03019 Messenger RNA biogenesis [BR:rro03019]
    104672769
   03036 Chromosome and associated proteins [BR:rro03036]
    104672769
   03029 Mitochondrial biogenesis [BR:rro03029]
    104672769
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rro04812]
    104672769
   04147 Exosome [BR:rro04147]
    104672769
Transcription machinery [BR:rro03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     104672769
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     104672769
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     104672769
    NuA4 complex
     104672769
  Chromatin remodeling factors
   BAF complex
    104672769
   PBAF complex
    104672769
   SWR1 complex
    104672769
Mitochondrial biogenesis [BR:rro03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    104672769
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     104672769
Exosome [BR:rro04147]
 Exosomal proteins
  Proteins found in most exosomes
   104672769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 104672769
NCBI-ProteinID: XP_030786926
LinkDB All DBs
Position
1
AA seq 375 aa AA seqDB search
MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGHTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVSLDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHHKCF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgatatcgccgcgctcgttgtcgacaacggctccggcatgtgcaaggccggc
ttcgcgggcgacgatgccccccgggccgtcttcccctccatcgtggggcgccccaggcac
cagggcgtgatggtgggcatgggtcagaaggattcatatgtgggcgacgaggcccagagc
aagagaggcatcctcaccctgaagtaccccatcgagcacggcatcgtcaccaactgggac
gacatggagaagatctggcaccacaccttctacaatgagctgcgtgtggctcctgaggag
caccccgtgctgctgaccgaggcccccctgaaccccaaggccaaccgcgagaagatgact
cagatcatgtttgagaccttcaacactccagccatgtacgtggccatccaggctgtgctg
tccctgtacgcctctggccataccactggcatcgtgatggactccggtgacggggtcacc
catactgtgcccatctacgaggggtatgccctcccccatgccatcctgcgtctggacctg
gctggccgggacctgactgactacctcatgaagatcctcactgagcgcggctacagtttc
accaccacggccgagcgggaaatcgtgcgtgacatcaaggagaagctgtgctatgtctcc
ctggacttcgagcaggagatggccacggcggcttccagctcctccctggagaagagctac
gagctgcccgatggccaggtcatcaccattggcaacgagcggttccgctgccctgaggct
ctcttccagccttcctttctgggcatggagtcctgtggcatccatgaaactaccttcaac
tccatcatgaagtgtgacgtggacatccgtaaagacctgtacgccaacacagtgctgtct
ggtggcaccaccatgtaccctggcattgctgacaggatgcagaaggagattactgccctg
gcgcccagcacgatgaaaatcaagattattgctcctcctgagcgcaagtactccgtgtgg
attggcggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtatgacgagtctggcccctccatcgtccaccacaaatgcttctag

DBGET integrated database retrieval system