KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672916
Entry
104672916         CDS       T03989                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04068  FoxO signaling pathway
rro04110  Cell cycle
rro04310  Wnt signaling pathway
rro04350  TGF-beta signaling pathway
rro04371  Apelin signaling pathway
rro04390  Hippo signaling pathway
rro04520  Adherens junction
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04659  Th17 cell differentiation
rro04933  AGE-RAGE signaling pathway in diabetic complications
rro05161  Hepatitis B
rro05166  Human T-cell leukemia virus 1 infection
rro05200  Pathways in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05220  Chronic myeloid leukemia
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104672916 (SMAD4)
   04350 TGF-beta signaling pathway
    104672916 (SMAD4)
   04390 Hippo signaling pathway
    104672916 (SMAD4)
   04371 Apelin signaling pathway
    104672916 (SMAD4)
   04068 FoxO signaling pathway
    104672916 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104672916 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104672916 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    104672916 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    104672916 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104672916 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104672916 (SMAD4)
   05212 Pancreatic cancer
    104672916 (SMAD4)
   05225 Hepatocellular carcinoma
    104672916 (SMAD4)
   05226 Gastric cancer
    104672916 (SMAD4)
   05220 Chronic myeloid leukemia
    104672916 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    104672916 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104672916 (SMAD4)
   05161 Hepatitis B
    104672916 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 104672916
NCBI-ProteinID: XP_010375088
UniProt: A0A2K6RQM2
LinkDB
Position
21
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPSIPVASTSQPASILGGSHTEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
agacttcaggtggctggccggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgttcatgactttgagggacagccatcgttgtccactgaaggacattcgattcaa
accatccagcatccaccaagtaatcgtgcgtcgacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccagcattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatactgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaacggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcggtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcagcagcaggcggccactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccgggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgctggaatcggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggaccagattacccaagacagagcatcaaagaa
acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt
cacaccatgccgattgcagacccacaacctttagactga

DBGET integrated database retrieval system