KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104672946
Entry
104672946         CDS       T03989                                 

Gene name
NKX6-1
Definition
(RefSeq) homeobox protein Nkx-6.1
  KO
K08030  homeobox protein Nkx-6.1
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    104672946 (NKX6-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104672946 (NKX6-1)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain ANTP: NKL
    104672946 (NKX6-1)
SSDB
Motif
Pfam: Homeodomain PKK
Other DBs
NCBI-GeneID: 104672946
NCBI-ProteinID: XP_010375116
UniProt: A0A2K6QVU6
LinkDB
Position
2
AA seq 367 aa
MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPTGPPSSSSSSSSSSSP
SPPLGTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPVASGAALPSASP
SSSSSSSSSSASASSSSAAAAAAAAAAAAASSPAGLLAGLPRFSSLSPPPPPPGLYFSPS
AAAVAAVGRYPKPLAELPGRTPIFWPGVMQSPPWRDARLACTPHQGSILLDKDGKRKHTR
PTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMA
TAKKKQDSETERLKGASENEEEDDDYNKPLDPNSDDEKITQLLKKHKSSSGGGGGLLLHA
SEPESSS
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgttagcggtgggggcaatggagggcacccggcagagcgcattcctgctcagcagcccg
cccctggccgccctgcacagcatggccgagatgaagaccccgctgtaccctgccgcgtat
cccccgctgcctaccggccccccctcttcctcgtcctcatcgtcgtcctcctcgtcgcca
tccccgcctctgggcacccacaacccaggcggcctgaagcccccggccacggggggcctc
tcatcccttggcagccccccgcagcagctctcggccgccaccccacatggtatcaacgac
atcctgagccggccctccatgcccgtggcctcgggggccgccctgccctccgcctcgccc
tccagttcctcctcctcctcttcctcgtccgcctctgcctcctcctcctctgccgccgcc
gcagctgctgccgcggccgcagccgccgcctcatccccggcggggctgctggctggactg
ccccgctttagcagcctgagcccgccgccgccgccgcccgggctctacttcagccccagc
gccgcggcggtggccgccgtgggccggtaccccaagccgctggctgagctgcccggccgg
acgcccatcttctggccgggagtgatgcagagtccgccttggagggacgcacgcctggcc
tgtacccctcatcaaggatccattttgttggacaaagacgggaagagaaaacacacgaga
cccactttttccggacagcagatcttcgccctggagaagactttcgaacaaacaaaatac
ttggcggggcccgagagggctcgtttggcctattcgttggggatgacggagagtcaggtc
aaggtctggttccagaaccgccggaccaagtggaggaagaagcacgcggctgagatggcc
acggccaagaagaagcaggactcggagaccgagcgcctcaagggggcctcggagaacgag
gaagaggacgacgactacaacaagcctctggatcccaactcggacgacgagaaaatcacg
cagctgctgaagaagcacaagtccagcagcggcggcggcggcggcctcctactgcacgcg
tccgagccggagagctcatcctga

DBGET integrated database retrieval system