KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673141
Entry
104673141         CDS       T03989                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04062  Chemokine signaling pathway
rro04140  Autophagy - animal
rro04151  PI3K-Akt signaling pathway
rro04210  Apoptosis
rro04370  VEGF signaling pathway
rro04510  Focal adhesion
rro04722  Neurotrophin signaling pathway
rro04910  Insulin signaling pathway
rro04919  Thyroid hormone signaling pathway
rro05010  Alzheimer disease
rro05014  Amyotrophic lateral sclerosis
rro05020  Prion disease
rro05022  Pathways of neurodegeneration - multiple diseases
rro05145  Toxoplasmosis
rro05152  Tuberculosis
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05162  Measles
rro05165  Human papillomavirus infection
rro05168  Herpes simplex virus 1 infection
rro05170  Human immunodeficiency virus 1 infection
rro05200  Pathways in cancer
rro05203  Viral carcinogenesis
rro05210  Colorectal cancer
rro05211  Renal cell carcinoma
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05218  Melanoma
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05223  Non-small cell lung cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104673141 (BAD)
   04014 Ras signaling pathway
    104673141 (BAD)
   04370 VEGF signaling pathway
    104673141 (BAD)
   04024 cAMP signaling pathway
    104673141 (BAD)
   04022 cGMP-PKG signaling pathway
    104673141 (BAD)
   04151 PI3K-Akt signaling pathway
    104673141 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104673141 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    104673141 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104673141 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    104673141 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    104673141 (BAD)
   04919 Thyroid hormone signaling pathway
    104673141 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    104673141 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673141 (BAD)
   05203 Viral carcinogenesis
    104673141 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104673141 (BAD)
   05212 Pancreatic cancer
    104673141 (BAD)
   05225 Hepatocellular carcinoma
    104673141 (BAD)
   05221 Acute myeloid leukemia
    104673141 (BAD)
   05220 Chronic myeloid leukemia
    104673141 (BAD)
   05218 Melanoma
    104673141 (BAD)
   05211 Renal cell carcinoma
    104673141 (BAD)
   05215 Prostate cancer
    104673141 (BAD)
   05213 Endometrial cancer
    104673141 (BAD)
   05223 Non-small cell lung cancer
    104673141 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104673141 (BAD)
   05014 Amyotrophic lateral sclerosis
    104673141 (BAD)
   05020 Prion disease
    104673141 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    104673141 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    104673141 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    104673141 (BAD)
   05161 Hepatitis B
    104673141 (BAD)
   05160 Hepatitis C
    104673141 (BAD)
   05162 Measles
    104673141 (BAD)
   05168 Herpes simplex virus 1 infection
    104673141 (BAD)
   05165 Human papillomavirus infection
    104673141 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    104673141 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104673141 (BAD)
   01524 Platinum drug resistance
    104673141 (BAD)
   01522 Endocrine resistance
    104673141 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 104673141
NCBI-ProteinID: XP_010375394
UniProt: A0A2K6PUL3
LinkDB
Position
15
AA seq 167 aa
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcctagtgagcaggaagactccagctctgcagagagg
ggcctgggccccagcccggcaggggacaggccctcagactccggcaagcatcatcgccag
gccccaggcctcctgtgggacgccagtcaccagcaggagcagccaaccagcagcagccat
catggaggcgctggggctgtggagacccggagtcgccacagctcctaccccgcggggacg
gaggaggacgaagggatggaggaggagcccagcccctttcggggccgctcgcgctccgcg
ccccctaacctctgggcagcacagcgatatggccgcgagctccggaggatgagtgacgag
tttgtggactcctttaagggacttcctcgcccgaagagcgcgggtacagcgacgcagatg
cggcaaagctccagctggacgcgagtcttccagtcctggtgggatcggaacttgggcagg
ggaagctccgccccctcccagtga

DBGET integrated database retrieval system