KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673171
Entry
104673171         CDS       T03989                                 

Gene name
BTC
Definition
(RefSeq) probetacellulin
  KO
K09783  betacellulin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104673171 (BTC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104673171 (BTC)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104673171 (BTC)
SSDB
Motif
Pfam: EGF Shisa Cadherin_C_2 Vpu Sigma_reg_N LapA_dom EphA2_TM TMEM154 TMEM52 Baculo_11_kDa Rhabdo_glycop CD34_antigen DAG1 TMEM100 YajC DUF4446
Other DBs
NCBI-GeneID: 104673171
NCBI-ProteinID: XP_010375436
UniProt: A0A2K6PXD6
LinkDB
Position
2
AA seq 178 aa
MDRAAPGSGASSLPLLLALALGLVILHCVVADENSTRSPETNGLLCGDPDDNCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVTEQTPSCVCDEGYIGARCERVDLFYLKGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMQTLGKDITPINEDIEETNIS
NT seq 537 nt   +upstreamnt  +downstreamnt
atggaccgggccgccccgggcagcggcgccagctccctgccactgctcctggcccttgcc
ctgggtctagtgatcctccactgtgtagtggcagatgaaaattccaccagaagtcctgaa
accaatggccttctctgtggagaccctgacgacaactgtgcagctaccaccacacaatca
aagcggaaaggccacttctctaggtgccccaagcaatacaagcattactgcatcaaaggg
agatgccgcttcgtggtgaccgagcagacgccctcctgtgtctgtgatgaaggctacatt
ggagcaaggtgtgagagagttgacttgttttacctaaaaggagacagaggacagattctg
gtgatttgtttgatagcagttatggtagtttttattattttggtcatcggcgtctgcaca
tgctgtcatcctcttcggaaacgtcgtaaaagaaagaagaaagaagaagaaatgcaaact
ctgggtaaagatataactcctatcaatgaagatattgaagagacaaatatttcttaa

DBGET integrated database retrieval system