KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673173
Entry
104673173         CDS       T03989                                 

Gene name
AREG
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04390  Hippo signaling pathway
rro05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104673173 (AREG)
   04012 ErbB signaling pathway
    104673173 (AREG)
   04390 Hippo signaling pathway
    104673173 (AREG)
   04151 PI3K-Akt signaling pathway
    104673173 (AREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    104673173 (AREG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rro03110]
    104673173 (AREG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104673173 (AREG)
Chaperones and folding catalysts [BR:rro03110]
 Intramolecular chaperones
  Others
   104673173 (AREG)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104673173 (AREG)
SSDB
Motif
Pfam: EGF FtsL
Other DBs
NCBI-GeneID: 104673173
NCBI-ProteinID: XP_010375437
UniProt: A0A2K6RH80
LinkDB
Position
2
AA seq 252 aa
MRAPLLPPAPVVLSLLILGSGHYAAGMDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSELSSGVDYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPKNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAIAVITVHLRKRYVRKYEGEAEERKK
LRQENGNVHAIA
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagagccccgctgctgccgccggcgccggtggtgctgtcgctcttgatactcggctca
ggccattatgctgctggaatggacctcaatgacacctactctgggaagcgtgaaccattt
tctggggaccacagtgctgatggatttgaggttacctcaagaagtgagatgtcttcagga
agtgaaatttcccctgtgagtgaaatgccttctagtagtgaactgtcctcgggagtcgac
tatgactattcagaagagtatgataatgaaccacaaatacctggctatattgtagatgat
tcagtcagagttgaacaggtagttaagccccccaaaaacaagacagaaagtgaaaatact
tcagataaacccaaaagaaagaaaaagggaggcaaaaatggaaaaaatagaagaaacaga
aagaagaaaaatccatgtaatgcagaatttcaaaatttctgcattcacggagaatgcaaa
tatatagagcacctggaagcagtgacatgcaaatgtcagcaagaatatttcggtgaacgg
tgtggggaaaagtccatgaaaactcacagcatgattgacagtagtttatcaaaaattgca
ttagcagccatagctgcctttatgtctgctgtgatcctcacagctattgctgttattaca
gtccatcttagaaaacgatacgtcaggaaatatgaaggagaagctgaggaacgaaagaaa
cttcgacaagagaatggaaatgtacatgctatagcataa

DBGET integrated database retrieval system