KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673174
Entry
104673174         CDS       T03989                                 

Gene name
EREG
Definition
(RefSeq) proepiregulin
  KO
K09784  epiregulin
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04151  PI3K-Akt signaling pathway
rro05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104673174 (EREG)
   04012 ErbB signaling pathway
    104673174 (EREG)
   04151 PI3K-Akt signaling pathway
    104673174 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    104673174 (EREG)
SSDB
Motif
Pfam: EGF CD34_antigen Sigma_reg_N Sec66 DUF2207 DcuC Insulin_TMD
Other DBs
NCBI-GeneID: 104673174
NCBI-ProteinID: XP_010375438
UniProt: A0A2K6Q641
LinkDB
Position
2
AA seq 163 aa
MEMLSAARVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRVAQVSIT
KCNSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFYLTVHQPLSKEYVALTVILI
ILFLIIVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
NT seq 492 nt   +upstreamnt  +downstreamnt
atggagatgctctctgccgccagggtccctgcgctgctgctctgcctgggtttccatctt
ctacaggcagtcctcagtacaactgtgattccatcatgtatcccaggagagtccagtgat
aactgcacagctttagttcagacagaagacaatccacgtgtggctcaagtgtcaataaca
aagtgtaactctgacatgaatggctactgtttgcatggacagtgcatctacctggtggac
atgagtcaaaattactgcaggtgtgaagtgggttatactggtgtccgatgtgaacacttc
tatttaaccgtccaccaacctttaagcaaagaatatgtggctttgaccgtgattcttatt
attttgtttcttatcatagttgtcggttccacatattatttctgcagatggtacaggaat
cgaaaaagtaaagaaccaaagaaggaatatgagagagttacctcaggggatccagagttg
ccgcaagtctga

DBGET integrated database retrieval system