KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673295
Entry
104673295         CDS       T03989                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma isoform X2
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03320  PPAR signaling pathway
rro04152  AMPK signaling pathway
rro04211  Longevity regulating pathway
rro04380  Osteoclast differentiation
rro04714  Thermogenesis
rro05016  Huntington disease
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    104673295 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    104673295 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    104673295 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    104673295 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    104673295 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104673295 (PPARG)
   05202 Transcriptional misregulation in cancer
    104673295 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    104673295 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    104673295 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104673295 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rro03310]
    104673295 (PPARG)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    104673295 (PPARG)
Nuclear receptors [BR:rro03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   104673295 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 104673295
NCBI-ProteinID: XP_010375595
UniProt: A0A2K6RRF2
LinkDB
Position
1
AA seq 475 aa
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPMV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKS
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggttgacacagagatgccattctggcccaccaactttgggatcagctccgtggatctc
tccgtaatggacgaccactcccactcctttgacatcaagcccttcactactgttgacttc
tccagcatttctactccacattatgaagacattccattcacaagaacagatccgatggtt
gcggattataagtatgacctgaaacttcaagagtaccaaagtgcaatcaaagtggagcct
gcatctccaccttattattctgagaagactcagctctacaataagcctcatgaagagcct
tcaaactccctcatggcaatcgaatgtcgtgtctgtggagataaagcttctggattccac
tatggagttcatgcttgtgaaggatgcaagggtttcttccggagaacaatcagattgaag
cttatctatgacagatgtgatcttaactgtcggatccacaaaaaaagtagaaataaatgt
cagtactgtcggtttcagaaatgccttgcagtggggatgtctcataatgccatcaggttt
gggcggatgccacaagccgagaaggagaagctgttggcggagatctccagtgatatcgac
cagctgaacccagagtccgctgacctccgggccctggcaaaacatttgtatgactcatac
ataaagtccttcccgctgaccaaagcaaaggcgagggcgatcttgacaggaaagacaaca
gacaaatcaccattcgttatctatgacatgaattccttaatgatgggagaagataaaatc
aagttcaaacacatcaccccgctgcaggagcagagcaaagaggtggccatccgcatcttt
cagggctgccagtttcgctccgtggaggctgtgcaggagatcacagagtatgccaaaagc
attcctggtttcgtaaatcttgacttgaacgaccaagtaactctcctcaaatatggagtc
catgagatcatttacacaatgctggcctccttgatgaataaagatggggttctcatatcc
gagggccaaggcttcatgacaagagagtttctaaagagcctgcgaaagccttttggtgac
tttatggagcccaagtttgagtttgctgtgaagttcaatgcactggaattagatgacagc
gacttggcaatatttattgctgtcattattctcagtggagaccgcccaggtttgctgaat
gtgaagcccattgaagacattcaagacaacctgctacaagccctggagctccagctgaag
ctgaaccaccctgagtcctcgcagctgtttgccaagctgctccagaaaatgacagacctc
agacagattgtcacggaacacgtgcagctactgcaggtgatcaagaagacggagacagac
atgagtcttcacccgctcctgcaggagatctacaaggacttgtactag

DBGET integrated database retrieval system