KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673322
Entry
104673322         CDS       T03989                                 

Gene name
TAS1R3
Definition
(RefSeq) taste receptor type 1 member 3 isoform X1
  KO
K04626  taste receptor type 1 member 3
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
rro04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    104673322 (TAS1R3)
  09157 Sensory system
   04742 Taste transduction
    104673322 (TAS1R3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rro04030]
    104673322 (TAS1R3)
G protein-coupled receptors [BR:rro04030]
 Others
  Chemoreception
   Taste
    104673322 (TAS1R3)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Other DBs
NCBI-GeneID: 104673322
NCBI-ProteinID: XP_010375617
UniProt: A0A2K6NDK5
LinkDB
Position
12
AA seq 852 aa
MLGPAVLGLSLWAVLHLGTGAPLCLSQQLRMKGDYVLGGLFPLSEAGEAGLGSRTQPSSP
VCTRFSSNGLLWALAMKMAVEEINNRSDLLPGLRLGYDLFDTCSEPVVAMKPSLMFLAKA
DSHDIAAYCNYTQYQPRVLAVIGPHSSELAVVTGKFFGFFLMPQVSYGASMELLSARETF
PSFFRTVPSDRVQLTAAVELLQEFGWNWVAALGSDDEYGRQGLGIFSTLAAAHSICIAHE
GLVPLPRADGPLLGKVQDVLHQVNQSSVQVVLLFASARAAHALFSYSISSKLSSKVWVAS
EAWLTSDLVMGLPGMAQVGTVLGFLQRGAQLHKFSQYVKTHLALAADPVFCAALGKREQG
LEEDVVGRRCPQCDCITLQNVSTGLNHHQTFSVYAAVYSVAQALHNTLQCNASGCPMQDP
VKPWQLLENMYNLTFHAGGLTLRFNSNGNVDMEYDLKLWVWQGSVPELHDVGRFNGSLWT
DSLKIRWHTSNNQKPVSQCSWQCQEGQVRRVKGFHSCCYDCVDCKAGSYQKSPDDLACSF
CNQDEWSPERSTRCFRRRLRFLAWGEPAVLLLLLLLSLALGLVLAALGLFIRHRDSPLVQ
ASGGPLACFGLVCLGLVCLSVLLFPGQPSPALCLAQQPSSHLPLTGCLSTLILQAAEIFV
ESELPLSWADRLSGCLRGPWAWLVVLLAMLVEAALCAWYLVAFPPEVVTDWHMLPTEALV
HCRTRSWVSFGLVHATNATLAFLCFLGTFLVQSRPGRYNRARGLTFAMLAYFITWVSFVP
LLANVQVVLRPAVQMGALLLCVLGILAAFHLPRCYLLVRQPELNTPEFFLGRGPGDARDR
NDGDTGNQGKPE
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgctgggccctgctgtcctgggccttagcctctgggctgtcctgcacctggggacaggg
gccccactgtgcctgtcacagcaacttaggatgaaaggggactacgtgctgggggggctg
ttccccctaagtgaggccggggaggctggcctcggcagccggacacagcccagcagcccc
gtgtgcaccaggttctcctcgaatggcctgctctgggcactggccatgaagatggctgtg
gaggagatcaacaacaggtcggacctgctgccgggcctgcgcctaggctacgatctcttc
gatacgtgctcggagcctgtggtggccatgaagcccagtctcatgttcctggccaaggca
gacagccacgacattgccgcctactgcaactacacgcagtaccagccccgcgtgctggcc
gtcatcgggccccactcgtcagagctcgccgtggtcaccggcaagttcttcggcttcttc
ctcatgccccaggtcagctatggcgctagcatggagctgctgagtgcccgggagaccttc
ccctccttcttccgcacagtgcccagcgaccgtgtgcagctgacggctgccgtggaactg
ctgcaggagttcggctggaactgggtggccgccctgggcagtgacgacgagtatggccgg
cagggcctgggcatcttctcgaccctggccgcggcgcacagcatctgtatcgcacacgag
ggcctggtgccactgccccgtgccgacggcccgctgctggggaaggtgcaggacgtgctg
caccaggtgaaccagagcagcgtgcaggtggtgctgctgttcgcctccgcgcgcgccgcc
cacgctctcttcagctacagcatcagcagcaagctctcgtccaaggtgtgggtggccagc
gaggcctggctgacctctgacctggtcatggggctgcccggcatggcccaggtgggcacg
gtgcttggctttctccagaggggtgcccagctgcacaagttctcccagtatgtgaagacc
cacctggccctggccgctgacccagtgttctgcgccgccctgggcaagagggagcagggt
ctggaggaggacgtggtgggccggcgctgcccgcagtgtgactgtatcacgctgcaaaac
gtgagcaccggactaaaccaccaccagacgttctctgtctacgcagctgtgtacagcgtg
gcccaggccctgcacaacactctgcagtgcaacgcctcaggctgccccatgcaggacccc
gtgaagccctggcagctcctggagaacatgtacaacctgaccttccacgcgggcgggctg
acgctacgcttcaacagcaacgggaacgtggacatggagtacgacctgaagctgtgggtg
tggcagggctcagtgcccgagctccacgatgtgggcaggttcaacggcagcctctggaca
gacagcctgaagatccgctggcacacgtccaacaaccagaagcccgtgtcccagtgctcg
tggcagtgccaggagggccaggtgcgccgggtcaaggggttccactcctgctgctacgac
tgcgtggactgcaaggcgggcagctaccagaagagcccagatgacctcgcctgctccttt
tgcaaccaggacgagtggtccccggagcggagcacacgctgcttccgccgcaggcttcga
ttcctggcatggggcgagccggctgtgctgctgctgctcctgctgctgagcctggccctg
ggccttgtgctggccgctttggggctgttcattcgccatcgtgacagcccactggttcag
gcctcgggtgggcccctggcctgctttggcctggtgtgcttgggcctggtctgccttagc
gtcctcctgttccctgggcagcccagccctgccctctgcctggcccagcagccctcatcc
cacctcccgctcaccggctgcctgagcacactcatcctgcaggcggccgagatctttgtg
gagtcagaactgcctctgagctgggcagaccggctgagtggctgcctgcgggggccctgg
gcctggctggtggtgctgctggccatgctggtggaggccgcactgtgcgcctggtacctg
gtggccttcccgccggaggtggtgacggactggcacatgctgcccacagaggcgctggtg
cactgccgcacacgctcctgggtcagctttggcctcgtgcatgccaccaacgccacactg
gccttcctttgcttcttgggcaccttcctggtgcagagccggccaggccgctacaaccgt
gcccgtggcctcacctttgccatgctggcctacttcatcacctgggtctccttcgtgcct
ctcctggccaatgtacaggtggtcctcaggcccgccgtgcagatgggtgccctcctgctc
tgcgtcctgggcattctggctgccttccacctgcccaggtgttacctgctcgtgcggcag
ccggagctcaacacccccgagttcttcctgggaaggggccctggggatgcccgagaccgg
aacgacggagacacaggaaatcaggggaaacctgagtga

DBGET integrated database retrieval system