KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673372Help
Entry
104673372         CDS       T03989                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro03030  DNA replication
rro03410  Base excision repair
rro03420  Nucleotide excision repair
rro03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104673372 (LIG1)
   03410 Base excision repair
    104673372 (LIG1)
   03420 Nucleotide excision repair
    104673372 (LIG1)
   03430 Mismatch repair
    104673372 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rro03032]
    104673372 (LIG1)
   03400 DNA repair and recombination proteins [BR:rro03400]
    104673372 (LIG1)
Enzymes [BR:rro01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104673372 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     104673372 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104673372 (LIG1)
DNA replication proteins [BR:rro03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104673372 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104673372 (LIG1)
DNA repair and recombination proteins [BR:rro03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104673372 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     104673372 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     104673372 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C Asp-B-Hydro_N DUF1685 DDR
Motif
Other DBs
NCBI-GeneID: 104673372
NCBI-ProteinID: XP_010375686
UniProt: A0A2K6QQN7
LinkDB All DBs
Position
Un
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSDSDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPAPDCSQVSPPRPATSPENSASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSVDEDRESKRKKEEEEVETPEESLAEAEVATEKEGEDRDQ
PTTPPKPLKTSEAGTPTESVSEPEVATRQELQEEEEQTKPPRSTPKTLSSFFTPRKPAIK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKLGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAV
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGQSLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVTPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcattcttccaccccaagaaagagggtaaagcgaagaagcct
gagaaggaggcatccaacagcagcagagagacggagccccctccaaaggcggcactgaaa
gagtggaatggagtggtgtctgatagtgactctccagtgaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgaggcccttagccctgctaaaggc
cagaagcctgccccggactgctcacaggtctccccgccccgtcctgccacatctcctgaa
aacagcgcttccctctctgacacctctcccatggacagctccccatcagggatcccgaag
cgtcgcacagctcggaagcagctcccgaaacggaccattcaggaagtcctggaagagcag
agtgtggacgaggacagagaatccaaaaggaagaaggaggaggaagaggtggagacccca
gaagaaagcctcgcagaggctgaagtggcaacagagaaggaaggagaagacagggaccag
cctaccacacctcccaagcccctaaagacctccgaagcagggactccaacggaaagcgtt
tcggagcccgaggtggccacaaggcaggaactgcaggaggaggaagagcagaccaagcct
ccccgcagcactcccaagacactcagcagcttcttcaccccccggaagccagcaatcaaa
aaagaagtgaaggaggaggagccaggggctccaggaaaggagggagctgctgagggaccc
ctggacccatctggttacaatcctgccaagaacaactaccatcccgtggaagacgcctgc
tggaaactgggccagaaggtcccttacctggctgtggcccggacgtttgagaagatcgag
gaggtgtctgcccggctccggatggtggagacgctgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctccctgtcctatacctcagcctcaaccaccttgggcca
ccgcagcagggcctggagcttggcgtgggtgatggcgtccttctcaaggcagtggcccag
gccacaggtcggcagctggagtccgtccgggctgaggcagccgagaagggcgacgtgggg
ctggtggccgagaacagccgcagcacccagaggctcatgctgccaccacctccgctcact
gcttccggggtcttcagcaagttccgtgacatcgccaggctcactggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccgccactcagaagcccgg
ttcatcgccaggtccctgagcggacggctgcgcctggggctggcagagcagtcggtgctg
gctgccctctcccaggctgtgagcctcacgcccccaggccaagaattcccaccagccgtg
gtggatgctgggaagggcaagacagcagaggccagaaagacatggctggaggagcaaggc
atgatcctgaagcagacgttctgcgaggtgcccgacctggaccgaattatccccgtgctg
ctggagcacggcctggaacgtctcccagagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacgcggggcgtcagcgaggttctgaaacgctttgaggag
gcagctttcacctgcgaatacaaatacgatgggcagagggcacagatccacgccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactggaaagtacccggac
atcatcagccgcatccccaagattaaactcccatcggtcacatccttcatcctggacacc
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaagtggatgcgtccgagatccaggtgcaggtgtgtttgtacgccttc
gacctcatctacctcaatggacagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacggagggcgagtttgtcttcgccacctctctggac
accaaggacgtcgagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgag
gggctgatggtgaagaccctggatgtcgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttgatggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggccggccggtacgggggcttcctgctg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agcgacgaggagctggaggaacatcaccagagcctcaaggccctggtgctgcccagcccc
cgcccttatgtgcggatagatggtgccgtgactccggaccactggctggaccccagtgct
gtgtgggaggtgaagtgtgccgacctctccctctctcccatctaccctgctgcgcggggc
ctggtggatagtgacaaggggatctcccttcgcttccctcggtttattcgagtccgtgaa
gacaagcagccggagcaggccaccaccagtgcacaggtggcctgtttgtaccggaagcaa
agtcagattcagaaccaacaaggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system