KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674035
Entry
104674035         CDS       T03989                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04022  cGMP-PKG signaling pathway
rro04141  Protein processing in endoplasmic reticulum
rro04151  PI3K-Akt signaling pathway
rro04211  Longevity regulating pathway
rro04261  Adrenergic signaling in cardiomyocytes
rro04668  TNF signaling pathway
rro04728  Dopaminergic synapse
rro04911  Insulin secretion
rro04915  Estrogen signaling pathway
rro04918  Thyroid hormone synthesis
rro04925  Aldosterone synthesis and secretion
rro04926  Relaxin signaling pathway
rro04927  Cortisol synthesis and secretion
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro04935  Growth hormone synthesis, secretion and action
rro05020  Prion disease
rro05030  Cocaine addiction
rro05031  Amphetamine addiction
rro05034  Alcoholism
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104674035 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    104674035 (ATF6B)
   04022 cGMP-PKG signaling pathway
    104674035 (ATF6B)
   04151 PI3K-Akt signaling pathway
    104674035 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    104674035 (ATF6B)
   04915 Estrogen signaling pathway
    104674035 (ATF6B)
   04926 Relaxin signaling pathway
    104674035 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    104674035 (ATF6B)
   04918 Thyroid hormone synthesis
    104674035 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    104674035 (ATF6B)
   04925 Aldosterone synthesis and secretion
    104674035 (ATF6B)
   04927 Cortisol synthesis and secretion
    104674035 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104674035 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    104674035 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    104674035 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    104674035 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    104674035 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    104674035 (ATF6B)
   05031 Amphetamine addiction
    104674035 (ATF6B)
   05034 Alcoholism
    104674035 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104674035 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104674035 (ATF6B)
   05161 Hepatitis B
    104674035 (ATF6B)
   05163 Human cytomegalovirus infection
    104674035 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104674035 (ATF6B)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    104674035 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 104674035
NCBI-ProteinID: XP_010376554
LinkDB
Position
4
AA seq 711 aa
MVGGWGGKMAELMLLSEIADPTRFFADNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCP
EQDVPFDGSSLDVGMDVSPPEPPWELLPILPDLQVKSEPSSPCSSSSRSSESSHLSTEPS
SEALGVGEVLHVKTESLAPPLCLLGDDPTSSFETVQINVVPTSDDCSDVQTKIEPVSPCS
SINSEASLLSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSPDGA
SGKALPTRKPPLQPKPVVLTTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQP
EGPAACLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISEPPSAPVSPRMNKGEPRPRRHLLGFSEQEPVHGVEPLQGSSQGPEEPQPSPTDQP
SFRNLTAFPGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQ
RAQERQKSQPRKKSPPVKAVPIQPPGPPERDAVGQLQLYRHPDRSQPAFLDAIDRREDTF
YVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDT
RVIHIKTSTVPPSLRKQPSPTPGNATGGPLPASAASQAHQASHPPLYLNHP
NT seq 2136 nt   +upstreamnt  +downstreamnt
atggttggggggtgggggggaaagatggcggagctgatgctcctgagcgagattgccgac
ccgacgcgtttcttcgccgacaacctgctgagcccggaggactggggtctgcagaacagc
accttgtattctggcctagatgaagtggccgaggagcagacgcagctcttccgttgcccc
gagcaggatgtcccgtttgacggcagctccctggacgtggggatggatgtcagcccccct
gagcccccatgggaactcctgccgatcttgccagatcttcaggtgaagtctgagccgtct
tccccctgctcttcctcctcccgcagctccgagtcatcacatctctccacagagccctcc
agcgaggctcttggggtaggggaggtgctccatgtgaagacagagtccttggcaccccca
ctgtgtctcctgggagatgacccaacatcctcatttgaaaccgtccagatcaacgtagtc
cccacctctgatgattgctcagatgtccagaccaagatagaacctgtctctccatgttct
tccatcaactctgaggcctccctgctctcagccgactcctccagccaggcttttatagga
gaggaggtcctggaagtgaagacagagtccctatccccttcagggtgcctcctgtgggat
gtcccagccccctcacttggagctgtccagatcagcatgggcccatcccctgatggcgcc
tcagggaaagccctgcccacccggaagccgccactgcagcccaaacctgtggtgctaacc
actgtcccaatgccacccagagctgtgcctcccagcaccaccgtccttctgcagcccctt
gtccagccacccccagtatccccagttgtcctcatccagggtgctattcgagtccagcct
gaagggccggctgcctgtctaccgcggcctgagaggaagagcattgttcctgctcctatg
cctggaaactcctgcccgcctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcagcctgccagtcccggagaaagaaaaaagagtatctgcagggg
ctggaggctcggctgcaggcagtactggctgacaaccagcagctccgccgggagaatgct
gccctccggcggcggctggaggccctgctggctgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttgga
cccgtcagcatcagtgagcctccttcagctcccgtctctcctcggatgaacaagggggag
cctcgaccccggagacacttgctggggttctcagagcaagagccagttcatggagttgaa
cctctccaggggtcctcccagggccctgaagagccccagcccagccccacagaccagccc
agtttcaggaacctgacagccttccccgggggcaccaaggagctactactgagagaccta
gaccagctcttcctctcctctgattgccggcacttcaaccgcaccgagtccctgaggctt
gctgatgagctgagtggctgggtccagcgccaccagagaggccggcggaagatccctcag
agggcccaggagagacagaagtctcagccacggaagaagtcacctccagttaaggcagtt
cccatccaaccccctggacccccagaaagggatgctgtgggccagctgcagctatatcgc
cacccagaccgttcgcagccagcgttcttggatgcaattgaccgacgggaagacacgttt
tatgttgtctctttccgaagggaccacctgctgctcccagccatcagccacaacaagacc
tcccggcccaagatgtccctggtgatgccggccatggcccccaatgagaccctgtcaggc
cgtggggccccgggggactatgaggagatgatgcagatcgagtgtgaggtcatggacacc
agggtgattcacatcaagacctccacggtgcccccctcgctccgaaagcagccctcccca
accccaggcaatgccacaggcggccccttgccagcctctgcagccagccaggcccatcag
gcctcccacccgcccctctacctcaatcatccctga

DBGET integrated database retrieval system