KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674171Help
Entry
104674171         CDS       T03989                                 

Gene name
SMYD1
Definition
(RefSeq) histone-lysine N-methyltransferase SMYD1 isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00310  Lysine degradation
rro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104674171 (SMYD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104674171 (SMYD1)
Enzymes [BR:rro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     104674171 (SMYD1)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     104674171 (SMYD1)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104674171 (SMYD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND DUF3369
Motif
Other DBs
NCBI-GeneID: 104674171
NCBI-ProteinID: XP_010376730
UniProt: A0A2K6Q9G8
LinkDB All DBs
Position
17
AA seq 490 aa AA seqDB search
MTIGRMENVEVFAAEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLVNFVCHTCFKRQE
KLHRCGQCKFAHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGTG
LTEGCLVSVDDLQNHVEHFGEEEQKELRVDMDTFLQYWPPQSQQFSMQYISHIFGVINCN
GFTLSDQRGLQAVGVGIFPNLGLVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALG
KISEGEELTVSYIDFLNVSEERKRQLKKQYYFDCTCEHCQKKLKDNLFLGVKDNPKPSQE
VVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLQKQEPVFADTNIYMLRILSIVSEV
LSYLQAFEEASDYARRMVDGYMKLYHPNNAQLGMAVMRAGLTNWHAGNIEVGHGMICKAY
TILLVTHGPSHPITKDLEAMRVQTEMELRMFRQNEFMYYKMREAALNNQPMQVMAEPSNE
PASALFHKKQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagggagaatggagaatgtggaggtcttcgctgctgagggcaaaggcaggggt
ctgaaggccaccaaggagttctgggctgcagatgtcatctttgctgagcgggcttattcc
gcagtggtttttgacagccttgttaattttgtgtgccacacctgcttcaagaggcaggag
aagctccatcgctgtgggcagtgcaagtttgcccattactgcgaccgcacctgccagaaa
gatgcttggttgaaccacaagaatgagtgttcggccatcaagagatacgggaaagtaccc
aatgagaacatcaggctggcggcgcgcatcatgtggcgggtggagagagaaggcaccggg
ctcacggagggctgcctggtgtctgtggacgacttgcagaaccacgtagagcactttggg
gaggaggagcagaaggagctgcgggtggacatggacacgttcttgcagtactggccgccc
cagagccagcagttcagcatgcagtacatctctcacatcttcggagtgattaactgcaac
ggttttactctcagtgatcagagaggcctgcaggccgtgggcgtaggcatcttccccaac
ctgggcctggtgaaccatgactgttggcccaactgcactgtcatatttaacaatggcaat
catgaggcagtgaaatccatgtttcatacccagatgagaattgaactccgggccctgggc
aagatctcagaaggagaggagctgactgtgtcctacatcgacttcctcaatgtcagtgaa
gaacgcaagaggcagctgaagaagcagtactactttgactgcacatgtgaacactgccag
aaaaaactgaaggacaacctcttcctgggggtgaaagacaaccccaagccctctcaggaa
gtggtgaaggagatgatacaattctccaaggatacattggaaaagatagacaaggctcgt
tcggagggtttgtatcatgaggttgtgaaattatgccgggagtgcctgcaaaagcaggag
ccagtgtttgctgacaccaacatctacatgctgcggatactgagcattgtttcggaggtc
ctttcctacctccaggcttttgaggaggcctcggactatgccaggaggatggtggacggc
tatatgaagctctaccaccccaacaatgcccaacttggcatggccgtgatgcgggcagga
ctgaccaactggcatgctggtaacattgaggtggggcatgggatgatctgcaaagcctat
accattctcctggtgacacacggaccctcccaccccatcaccaaggacttagaggccatg
cgagtgcagacggagatggagctacgcatgttccgtcagaatgaattcatgtactacaag
atgcgcgaggctgccctgaacaatcagcccatgcaggtcatggctgagcccagcaatgag
ccagcctcagctctgttccacaagaagcaatga

DBGET integrated database retrieval system