KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674327
Entry
104674327         CDS       T03989                                 

Gene name
P2RX2
Definition
(RefSeq) P2X purinoceptor 2 isoform X1
  KO
K05216  P2X purinoceptor 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04080  Neuroactive ligand-receptor interaction
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104674327 (P2RX2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    104674327 (P2RX2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104674327 (P2RX2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104674327 (P2RX2)
Ion channels [BR:rro04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   104674327 (P2RX2)
SSDB
Motif
Pfam: P2X_receptor WAP
Other DBs
NCBI-GeneID: 104674327
NCBI-ProteinID: XP_030795674
LinkDB
Position
10
AA seq 470 aa
MAAAQPKPPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYV
FIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQ
TQGTCPESIRVHNATCLSDADCVTGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVED
GASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFK
LGFIVEKAGESFAELAYKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYN
FRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCD
WILLTFMNKNKVYSHKKFDKVCTPSRPSGSWPVTLARVLGQAPPQPGHCSEDQHPSPPSS
QEGQQGAECGPAFPPLRPCPISAPSKQITPASEPAPQASTPTDPKGLAQL
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggccgccgcccagcccaagccccccgcgggggcgaccgcccggcgcctggcccggggc
tgctggtccgccctctgggactacgagacgcccaaggtgatcgtggtgaggaaccggcgc
ctgggcgtcctgtaccgcgctgtgcagctgctcatcctgctctacttcgtgtggtacgta
ttcatcgtgcagaaaagctaccaggagagcgagacgggcccggagagctccatcatcacc
aaggtcaaggggatcaccacgtccgagcacaaagtgtgggacgtggaggagtatgtgaag
cccccggaggggggcagcgtgttcagcatcatcaccagggtcgaggccacccactcccag
acccagggaacctgccccgagagcataagggtccacaatgccacctgcctctccgacgcc
gactgtgtgactggggagctggacatgctgggaaacggcctgcggaccgggcgctgtgtg
ccctattaccaggggccctccaagacctgcgaggtgttcggctggtgcccggtggaagat
ggggcctctgtcagccaatttctgggtacaatggccccaaatttcaccatcctcatcaag
aacagcatccactaccccaaattccacttctccaagggcaacatcgcggaccgcacagac
gggtacctgaagcgctgcacgttccacgaggcctccgacctctactgccccatcttcaag
ctgggctttattgtggaaaaggctggggagagcttcgcggagctggcatacaagggtggt
gtcatcggggtcattatcaactgggactgtgacctggacctgcctgcgtcggagtgtaac
cccaagtactccttccggaggcttgaccccaagcacgtgcctgcctcgtcaggctacaac
ttcaggtttgccaagtactacaagatcaatggtaccaccacccgcacactcatcaaagcc
tacgggatccgcattgacgtcatcgtgcatggacaggccgggaaattcagcctgattccc
accattattaatctggccacagctctaacttccgtcggggtgggctccttcctgtgcgac
tggatcttgctaacattcatgaacaaaaacaaggtctacagccacaagaaatttgacaag
gtgtgtacgccgagccgcccctcaggtagctggcctgtgacccttgcccgtgttttgggc
caggccccaccccaacccggccactgctccgaggaccagcaccccagccctccatcaagc
caggagggccaacaaggggcagagtgtggcccagccttcccacccctgcggccttgcccc
atctctgccccatctaagcagatcactcctgcctccgagcctgccccacaagcctccacg
cccacagaccccaaaggtttggcccaactctga

DBGET integrated database retrieval system