KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674341
Entry
104674341         CDS       T03989                                 

Gene name
AP3S2
Definition
(RefSeq) AP-3 complex subunit sigma-2 isoform X1
  KO
K12399  AP-3 complex subunit sigma
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rro00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104674341 (AP3S2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rro04131]
    104674341 (AP3S2)
Membrane trafficking [BR:rro04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    104674341 (AP3S2)
 Endosome - Golgi transport
    104674341 (AP3S2)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 104674341
NCBI-ProteinID: XP_010376923
LinkDB
Position
5
AA seq 193 aa
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIG
DLNIKVPNLSQFV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattcaggcgattctggttttcaacaaccatggaaagccgcggctagtccgcttctac
cagcgtttcccagaagaaattcaacagcagattgttcgagagactttccatctagtcctt
aagcgggatgacaacatctgtaacttcttggagggtggaagtttgattggtggctctgac
tacaaactgatctaccgacactatgctaccctctactttgtattttgtgtggattcctca
gagagtgaacttggaatcttggacctcatccaggtttttgtggaaactctggataagtgt
tttgaaaatgtgtgtgaattggatttgatcttccacatggataaggtacactacatcctc
caggaggtggtgatgggtgggatggtgttagaaacaaacatgaatgaaatcgtggctcag
attgaagctcaaaacaggctggagaaatctgagggtggcctttcagcagcccctgcgcgg
gctgtgtctgctgtgaaaaacatcaacctgccagagattcctcggaacatcaacattggc
gatctcaacatcaaagttcccaacctgtcccagtttgtctga

DBGET integrated database retrieval system