KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674641
Entry
104674641         CDS       T03989                                 

Gene name
MYL2
Definition
(RefSeq) myosin regulatory light chain 2, ventricular/cardiac muscle isoform
  KO
K10351  myosin regulatory light chain 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04371  Apelin signaling pathway
rro04510  Focal adhesion
rro04530  Tight junction
rro04670  Leukocyte transendothelial migration
rro04810  Regulation of actin cytoskeleton
rro05132  Salmonella infection
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104674641 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104674641 (MYL2)
   04530 Tight junction
    104674641 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104674641 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    104674641 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104674641 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    104674641 (MYL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104674641 (MYL2)
   05414 Dilated cardiomyopathy
    104674641 (MYL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104674641 (MYL2)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     104674641 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 104674641
NCBI-ProteinID: XP_010377332
UniProt: A0A2K6PJW6
LinkDB
Position
10
AA seq 166 aa
MAPKKAKKRAEGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
DMLTTQAERFSKDEIDQMFAAFPPDVTGNLNYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagagccgagggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcatcgacaagaacgatctgagagacacctttgctgcccttgggcgtgtgaac
gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccaggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcggaccctgaggaaaccatactc
aacgcattcaaagtgtttgaccctgaaggcaaaggggtgttgaaggctgattacgttcgg
gacatgctgaccacgcaggcggagaggttttccaaggatgagattgaccagatgtttgcc
gccttcccccctgacgtgactggcaacttgaactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

DBGET integrated database retrieval system