KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674758
Entry
104674758         CDS       T03989                                 

Gene name
TNNI3
Definition
(RefSeq) troponin I, cardiac muscle
  KO
K12044  troponin I, cardiac muscle
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04024  cAMP signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro05410  Hypertrophic cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    104674758 (TNNI3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104674758 (TNNI3)
   04261 Adrenergic signaling in cardiomyocytes
    104674758 (TNNI3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104674758 (TNNI3)
   05414 Dilated cardiomyopathy
    104674758 (TNNI3)
Cytoskeleton proteins [BR:rro04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     104674758 (TNNI3)
SSDB
Motif
Pfam: Troponin Troponin-I_N Tup_N DUF919 DUF3738 CorA
Other DBs
NCBI-GeneID: 104674758
NCBI-ProteinID: XP_010377477
UniProt: A0A2K6RCK6
LinkDB
Position
12
AA seq 210 aa
MADKSSDVAGEPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE
LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK
NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED
TEKENREVGDWRKNIDALSGMEGRKKKFEG
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcggataagagcagcgatgtggctggggaacctcggcctgcaccagccccaatcaga
cgacgctcctccaactaccgcgcttacgccacagagccgcacgccaagaaaaaatctaag
atctccgcctcgagaaaattgcagctgaagaccctgctgctgcagattgcaaagcaggag
ctggagcgagaggcggaggagcggcgcggagagaaggggcgcgctctgagcacccgctgc
cagccgctggagttggccgggctgggcttcgcggagctgcaggacttgtgccgacagctc
catgcccgtgtggataaggtggatgaagagagatatgacatagaggcaaaagtcaccaag
aacatcacggagatcgcagatctgacccagaagatctttgaccttcggggcaagtttaag
cggcccaccctgcggagagtgaggatctctgcagacgccatgatgcaggcgctgctgggg
gcccgggctaaggagtccctggacctgcgggcccacctcaagcaggtgaagaaggaggac
accgagaaggaaaaccgggaggtgggagactggcgcaagaacatcgatgcactgagtgga
atggagggccgcaagaaaaagtttgagggctga

DBGET integrated database retrieval system