KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674764
Entry
104674764         CDS       T03989                                 

Gene name
KMT5C
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5C isoform X1
  KO
K11429  [histone H4]-N-methyl-L-lysine20 N-methyltransferase [EC:2.1.1.362]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00310  Lysine degradation
rro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104674764 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rro03036]
    104674764 (KMT5C)
Enzymes [BR:rro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.362  [histone H4]-N-methyl-L-lysine20 N-methyltransferase
     104674764 (KMT5C)
Chromosome and associated proteins [BR:rro03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104674764 (KMT5C)
SSDB
Motif
Pfam: SET
Other DBs
NCBI-GeneID: 104674764
NCBI-ProteinID: XP_010377490
UniProt: A0A2K6QVI7
LinkDB
Position
12
AA seq 461 aa
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTVGGWTAHYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERRGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQGLDSGGRQGLLGPRVCVHPSPLRRDPFCAAC
QPLRLPACSARPDTSPLWLQWLPQPQPRVRSRKRRRPRPRRAPVLSTHHAARISLHRWGG
CGPHCRLRGEALVALGQPPRARWVPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPDPAG
TPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVDGEEL
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggggccggacagagtgacagcacgagaactgtgtgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggtttccgcacccataagatgaacgtcagccctgtgccc
ccactgcggcgacagcagcacctgcgctcagcgctggaaactttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacggtgggaggctggacggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacgtctatcgctacctccgtgccttc
ctgccggaaagtggctttactatcctgccctgcacgcgctactccatggagaccaacggg
gccaagatcgtgtccactcgtgcttggaaaaagaatgagaagctggagctgctggtgggc
tgcatcgcagagctgcgggaggcggatgaggggctgctgagggccggtgagaatgacttc
agcatcatgtactcaacccgcaagcgaagtgctcagctgtggctgggcccagccgccttc
atcaaccatgactgcaagcccaactgcaagtttgtgcctgcagatgggaacgccgcctgt
gtcaaggtgctccgggacatcgagcctggggacgaggtgacgtgcttctacggtgagggc
ttcttcggggagaagaatgagcactgtgaatgctacacctgtgagaggagaggcgaagga
gctttccgaacgagacctagggagcctgcgttgccaccacggcccctggacaagtaccag
ctacgtgagaccaagcggcggctgcaaggcctggacagcggcggccgacagggcctgctg
ggccctcgggtctgcgtgcacccgtccccactgcgccgggacccgttctgtgccgcctgc
caacccctgcgcctgccagcctgtagtgcccgcccagacacctcacccctctggctccag
tggctgcctcagccccagccccgagtgcggtcccggaagcgccgacgcccccggccccgg
agggccccagtgctctccacccaccatgccgcccgcatctccctgcaccgatggggaggc
tgtggcccccactgccgcctgcgaggagaggccctggtggccctgggccagcccccccgc
gcccgctgggtcccccagcaggactggcactgggcccggcgctatgggctgccttacgtg
gtgcgggtggaccttcgtcgcctggccccagccccaccagccaccccagaccctgctggg
accccaggccccatcctgatcccgaagcaggccctcgccttcgcccccttctccccaccc
aagcgcctacggctggtggtcagccacggttccatcgacctagatgtcgacggtgaagag
ctgtga

DBGET integrated database retrieval system