KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674798
Entry
104674798         CDS       T03989                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04110  Cell cycle
rro04151  PI3K-Akt signaling pathway
rro04218  Cellular senescence
rro04310  Wnt signaling pathway
rro04350  TGF-beta signaling pathway
rro04390  Hippo signaling pathway
rro04550  Signaling pathways regulating pluripotency of stem cells
rro04630  JAK-STAT signaling pathway
rro04919  Thyroid hormone signaling pathway
rro05132  Salmonella infection
rro05160  Hepatitis C
rro05161  Hepatitis B
rro05163  Human cytomegalovirus infection
rro05166  Human T-cell leukemia virus 1 infection
rro05167  Kaposi sarcoma-associated herpesvirus infection
rro05169  Epstein-Barr virus infection
rro05200  Pathways in cancer
rro05202  Transcriptional misregulation in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05213  Endometrial cancer
rro05216  Thyroid cancer
rro05219  Bladder cancer
rro05220  Chronic myeloid leukemia
rro05221  Acute myeloid leukemia
rro05222  Small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104674798 (MYC)
   04012 ErbB signaling pathway
    104674798 (MYC)
   04310 Wnt signaling pathway
    104674798 (MYC)
   04350 TGF-beta signaling pathway
    104674798 (MYC)
   04390 Hippo signaling pathway
    104674798 (MYC)
   04630 JAK-STAT signaling pathway
    104674798 (MYC)
   04151 PI3K-Akt signaling pathway
    104674798 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104674798 (MYC)
   04218 Cellular senescence
    104674798 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    104674798 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104674798 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104674798 (MYC)
   05202 Transcriptional misregulation in cancer
    104674798 (MYC)
   05206 MicroRNAs in cancer
    104674798 (MYC)
   05205 Proteoglycans in cancer
    104674798 (MYC)
   05230 Central carbon metabolism in cancer
    104674798 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104674798 (MYC)
   05225 Hepatocellular carcinoma
    104674798 (MYC)
   05226 Gastric cancer
    104674798 (MYC)
   05216 Thyroid cancer
    104674798 (MYC)
   05221 Acute myeloid leukemia
    104674798 (MYC)
   05220 Chronic myeloid leukemia
    104674798 (MYC)
   05219 Bladder cancer
    104674798 (MYC)
   05213 Endometrial cancer
    104674798 (MYC)
   05224 Breast cancer
    104674798 (MYC)
   05222 Small cell lung cancer
    104674798 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104674798 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    104674798 (MYC)
   05161 Hepatitis B
    104674798 (MYC)
   05160 Hepatitis C
    104674798 (MYC)
   05163 Human cytomegalovirus infection
    104674798 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    104674798 (MYC)
   05169 Epstein-Barr virus infection
    104674798 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rro03000]
    104674798 (MYC)
   03019 Messenger RNA biogenesis [BR:rro03019]
    104674798 (MYC)
Transcription factors [BR:rro03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    104674798 (MYC)
Messenger RNA biogenesis [BR:rro03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     104674798 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 104674798
NCBI-ProteinID: XP_010377525
UniProt: A0A2K6PIE5
LinkDB
Position
9
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASPDSSAFSPSSDSLLSSTESSPQASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVHAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcaacagcagagcgagctg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcccttc
tcccctcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgacccggac
gacgagaccttcatcaaaaatatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcagagaagctagcctcctaccaggctgcgcgcaaagacagcggc
agcccgaaccctgcccgcggccacagcgtctgctccacctccagcttgtatctgcaggat
ctgagcgccgccgcctcggagtgcatcgacccctcagtggtctttccctaccctctcaac
gacagcagctcgcccaagtcctgcgcctcaccggactccagcgccttctcaccgtcctcg
gattctctgctctcctcgacggagtcctccccgcaggccagcccagagcccctggtgctc
catgaggagacaccgcccaccaccagcagcgactctgaggaggaacaagaagatgaggaa
gaaatcgatgttgtttctgtggaaaagaggcaggcccctggcaaaaggtcagagtcagga
tcaccttctgctggaggccacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaattatgcagcgcctccctccactcggaaggactatcct
gctgccaagagggtcaagttggacagtgtcagagtcctgagacagatcagcaacaaccga
aaatgcaccagccccaggtcctcggacaccgaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaacgagctaaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccgtccacgcagaggagcaaaagctcatttctgaaaaggatttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system