KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674813
Entry
104674813         CDS       T03989                                 

Gene name
ATP2A2
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform X3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04919  Thyroid hormone signaling pathway
rro04972  Pancreatic secretion
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104674813 (ATP2A2)
   04024 cAMP signaling pathway
    104674813 (ATP2A2)
   04022 cGMP-PKG signaling pathway
    104674813 (ATP2A2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104674813 (ATP2A2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104674813 (ATP2A2)
   04261 Adrenergic signaling in cardiomyocytes
    104674813 (ATP2A2)
  09154 Digestive system
   04972 Pancreatic secretion
    104674813 (ATP2A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104674813 (ATP2A2)
   05017 Spinocerebellar ataxia
    104674813 (ATP2A2)
   05022 Pathways of neurodegeneration - multiple diseases
    104674813 (ATP2A2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104674813 (ATP2A2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104674813 (ATP2A2)
   05414 Dilated cardiomyopathy
    104674813 (ATP2A2)
Enzymes [BR:rro01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     104674813 (ATP2A2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 104674813
NCBI-ProteinID: XP_010377551
UniProt: A0A2K6RPZ0
LinkDB
Position
10
AA seq 997 aa
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAVGDKVPADIRLTSIKSTTLRVDQSIL
TGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAMGVVVATGVNTEIGKIRDEMV
ATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFILDRVEGDTCSLNEFTITGSTYAPIGEVHKDDKPVKCHQYDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTELKGLSKIERANACNSVIKQLMK
KEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGAPEGVIDRCTHIRVGSTKVPMTSGV
KQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMHLEDSANFIKYETNLTFVGCVGMLD
PPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICRRIGIFGQDEDVTSKAFTGREFDEL
NPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEITAMTGDGVNDAPALKKSEIGIAMG
SGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAAL
GFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIG
CYVGAATVGAAAWWFIAADGGPRVTFYQLSHFLQCKEDNPDFEGVDCAIFESPYPMTMAL
SVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSICLSMSLHFLILYVEPLPLIFQITP
LNVTQWLMVLKISLPVILMDETLKFVARNYLEPAILE
NT seq 2994 nt   +upstreamnt  +downstreamnt
atggagaacgcgcacacaaagacggtggaggaggtgctgggccacttcggcgtcaacgag
agtacggggctgagcctggagcaggtcaagaagctcaaggagagatggggctccaacgag
ttaccggctgaagaaggaaaaaccttgctggaacttgtgattgagcagtttgaagacttg
ctagttaggattttattactggcagcatgtatatcttttgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccttttgtaattttactcatattagtagcc
aatgcaattgtgggtgtatggcaggaaagaaatgctgaaaatgccatcgaagcccttaag
gaatatgagcctgaaatgggcaaagtgtatcgacaggacagaaagagtgtacagcggatt
aaagctaaagacatagttcctggtgatattgtagaaattgctgttggtgacaaagttcct
gctgatataaggttaacttccatcaaatctaccacactaagagttgaccagtcgattctc
acaggtgagtctgtctctgtcatcaagcacactgaccccgtccctgacccacgagctgtc
aaccaagataaaaagaacatgctgttttctggtacaaacattgctgctgggaaagctatg
ggagtggtggtagcaactggagttaacactgaaattggcaagatccgggatgaaatggtg
gcaacagaacaggagagaacaccccttcagcaaaaactagatgaatttggggaacagctt
tccaaagtcatctcccttatttgcattgcagtctggatcataaatatcggtcacttcaat
gacccagttcatggagggtcctggatcagaggtgctatttactactttaaaattgcagtg
gccctggctgtagcagccattcctgaaggtctgcctgcagtcatcaccacctgcctggct
cttggaactcgcagaatggcaaagaaaaatgctattgttcgaagcctcccgtctgtggaa
acccttggttgtacttctgttatctgctcggacaagactggtacacttacaacaaaccag
atgtcagtctgcaggatgttcattctggacagagtggaaggtgatacttgttcccttaat
gaatttaccataactggatcaacttatgcacctattggagaagtgcataaagatgataaa
ccagtgaaatgtcaccagtatgatgggctggtagaattagcaacaatttgtgctctttgt
aatgactctgctttggattacaatgaggcaaagggtgtgtatgaaaaagttggagaagct
acagagactgctctcacttgcctagtagagaagatgaatgtatttgataccgaattgaag
ggtctttctaaaatagaacgtgcaaatgcctgcaactcagtcattaaacagctgatgaaa
aaggaatttactctcgagttttcacgtgacagaaagtcaatgtcagtttattgtacacca
aataaaccaagcaggacatcaatgagcaagatgtttgtgaagggtgctcctgaaggtgtc
attgacaggtgcacccacattcgagttggaagtactaaggttcccatgacctctggagtc
aaacagaagatcatgtctgtcattcgagagtggggtagtggcagcgacaccctgcgatgc
ctggccctggccactcacgacaacccactgagaagagaagaaatgcaccttgaagactct
gccaactttattaaatatgagaccaatctgaccttcgttggctgtgtgggcatgctggat
cctccaagaatcgaggtggcctcctccgtgaagctgtgccggcaagcaggcatccgggtc
atcatgatcactggggacaacaagggcactgctgtggccatctgtcgccgcattggcatc
ttcggacaggatgaggatgtgacgtcaaaagctttcacaggccgggagtttgatgaactc
aacccctctgcccagcgagatgcctgcctgaacgcccgctgttttgctcgagttgaaccc
tcccacaagtctaaaattgtagaatttcttcagtcttttgatgagattacagctatgact
ggtgatggcgtgaatgatgctcctgctctgaagaaatctgagattggcattgctatgggc
tctggcactgcggtggctaaaactgcctctgagatggtcctggcggatgacaacttctcc
accattgtggctgccgttgaggaggggcgggcaatctacaacaacatgaaacagttcatc
cgctacctcatctcgtccaacgttggggaagttgtctgtattttcctgacagcagccctt
ggatttcccgaggctttgataccggttcagctgctctgggtcaatctggtgacagatggc
ctgcctgccactgcactgggcttcaaccctcctgatctggacatcatgaataaacctccc
cggaacccaaaggaaccattgatcagcgggtggctctttttccgttacttggctattggc
tgttacgtcggcgctgctaccgtgggtgctgctgcatggtggttcattgctgctgacggt
ggtccaagagtgaccttctaccagctgagtcatttcctacagtgtaaagaggacaacccg
gactttgaaggcgtggattgtgcaatctttgaatccccatacccgatgacaatggcgctc
tctgttctagtaactatagaaatgtgtaacgccctcaacagcttgtccgaaaaccagtcc
ttgctgaggatgcccccctgggagaacatctggctcgtgggctccatctgcctgtccatg
tcactccacttcctgatcctctatgtcgaacccttgccactcatcttccagatcacaccg
ctgaacgtgacccagtggctgatggtgctgaaaatctccttgcccgtgattctcatggac
gagacgctcaagtttgtggcccgcaactacctggaacctgcaatactggagtaa

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677250
Entry
104677250         CDS       T03989                                 

Gene name
ATP2A3
Definition
(RefSeq) LOW QUALITY PROTEIN: sarcoplasmic/endoplasmic reticulum calcium ATPase 3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04919  Thyroid hormone signaling pathway
rro04972  Pancreatic secretion
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104677250 (ATP2A3)
   04024 cAMP signaling pathway
    104677250 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    104677250 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104677250 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104677250 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    104677250 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    104677250 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104677250 (ATP2A3)
   05017 Spinocerebellar ataxia
    104677250 (ATP2A3)
   05022 Pathways of neurodegeneration - multiple diseases
    104677250 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104677250 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104677250 (ATP2A3)
   05414 Dilated cardiomyopathy
    104677250 (ATP2A3)
Enzymes [BR:rro01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     104677250 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD DUF3106
Other DBs
NCBI-GeneID: 104677250
NCBI-ProteinID: XP_030778514
LinkDB
Position
19
AA seq 1085 aa
MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPTEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNIASGKAVGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDLPVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNAVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRMGSHTAPLTPT
SREQILAKIRDWGSGSDTLRCLALATRDVPPRKEDMELDDCSKFVQYETDLTFVGCVGML
DPPRPEVAACITRCHQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDD
LSPEQQRHACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPREALISGWLFFRYLAI
GVYVGLATVAAATWWFLYDAEGPHVNFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLAAVAMSMALHFLILLVPPLPLIFQVT
PLSGRQWVVVLQISLPVILLDEAFKYLSRNHVDGILRTVSQAWSRQPMTASWTPDHTGLA
SSVSPCGKKEPEVSAGNGVESLGAAAALSAQLGASEPGGLSWTLGHIPCPLRTTPMSRKD
VTKDG
NT seq 3258 nt   +upstreamnt  +downstreamnt
atggaggcggcgcacctgctcccggccgccgacgtgctgcgccacttctcggtgacagcc
gagggcggcctgagcccggcgcaggtgaccggcgcgcgggagcgctacggccccaacgag
ctcccgactgaggaagggaagtccctgtgggagctggtgctggaacagtttgaggacctc
ctggtgcgcatcctgctgctggccgcccttgtctcctttgtcctggcctggttcgaggag
ggcgaggagaccacgaccgcctttgtggagcccctggtcatcatgctgatcctcgtggcc
aacgccattgtgggcgtgtggcaggaacgcaacgctgagagtgccatcgaggccctgaag
gagtatgagcctgagatgggcaaggtgatccgctcggaccgcaagggcgtgcagaggatc
cgtgcccgggacatcgtcccaggggacattgtagaagtggcggtgggggacaaagtgcct
gctgatctccgcctcatcgagatcaagtccaccacgctgcgagtggaccagtccatcctg
acgggtgaatctgtgtccgtgaccaagcacacagaggccatcccagaccccagagctgtg
aaccaggacaagaagaacatgctgttttctggcaccaatatcgcctcgggcaaagcagtg
ggtgtggccgtggccactggcctgcacacggagctgggcaagattcggagccagatggcg
gcagtggagcccgagcggacgccgctgcagcgcaagctggatgagtttgggcggcagctg
tcccacgccatctctgtgatctgcgtggccgtgtgggtcatcaacattggccacttcgct
gacccagcccatggtggctcctggctgcgtggcgctgtctactacttcaagatcgccgtg
gccctggctgtggcggccatccccgagggcctcccggccgtcatcactacgtgcctggcc
ctgggcacgaggcgcatggcacgcaagaacgccatcgtgagaagcctgccctccgtggag
accctgggctgcacctcggtcatctgctctgacaagacgggcacgctcaccaccaatcag
atgtctgtctgccggatgttcgtggtagccgaggccgatgcgggctcctgccttttgcac
gagttcaccatctcgggtaccacgtatacccccgagggcgaagtgcggcagggggatctg
cctgtgcgctgcggccagttcgacgggctggtggagctggcgaccatctgcgccctgtgc
aacgactcggcgctggactacaatgaggccaagggtgtgtacgagaaggtgggagaggcc
acggagacagctctgacttgcctggtggagaagatgaacgtgtttgacactgacctgcag
gccctgtcccgggtggagcgagctggcgcctgtaatgcggtcatcaagcagctgatgcgg
aaagagttcaccctggagttctcccgagaccggaagtccatgtccgtctactgcacgccc
acccgccctcaccctaccggccagggcagcaagatgtttgtgaagggggctcctgagagt
gtaatcgagcgctgcagctcagtccgcatggggagccacacagcacccctgacccccacc
tccagggagcagatcctggcaaagatacgggattggggctcaggctcagacacgctgcgc
tgcctggcactggccacccgggacgtgcccccgaggaaggaggacatggagctggacgac
tgcagcaagtttgtgcagtacgagacggacctgactttcgtgggctgcgtgggcatgctg
gacccgccgcggcctgaggtggctgcctgcatcacacgctgccaccaggcgggcatccgc
gtggtcatgatcacgggcgataacaaaggcactgccgtggccatctgccgcaggcttggc
atctttggggacacggaagatgtggcgggcaaggcctacacgggccgcgagtttgatgac
ctcagccccgagcagcagcgccatgcctgccgcaccgcccgctgcttcgcccgcgtggag
cccgcacacaagtcccgcatcgtggagaacctgcagtcctttaacgagatcaccgccatg
actggtgatggagtaaacgacgcaccagccctgaagaaagcagagatcggcatcgccatg
ggctcaggcacggctgtggccaagtcggcggcagagatggtgctgtccgatgacaacttt
gcctccatcgtggctgcagtggaggagggccgggccatctacaacaacatgaagcaattc
atccgctacctcatctcctccaatgttggcgaggtcgtctgcatcttcctcacggcaatt
ctgggcctgcccgaagccctgatccctgtgcagcttctctgggtgaacctggtgacagac
ggcctacctgctacggctctgggcttcaacccgccagacctggacatcatggagaagctg
cctcggaacccccgagaagccctcatcagtggctggctcttcttccgatacctggctatc
ggagtgtacgtaggcctggccacagtggctgccgccacctggtggttcctatatgatgcc
gagggacctcacgtcaacttctaccagctgaggaacttcctgaagtgttctgaagacaac
ccgctctttgctggcatcgactgtgaggtgttcgagtcgcgcttccccaccaccatggcc
ttgtctgtgctcgtgaccattgaaatgtgcaatgccctcaacagcgtctcggagaaccag
tcgctgcttcggatgccgccctggatgaacccctggctgctggcggctgtggccatgtcc
atggccctgcacttcctcatcctgctcgtgccacccctgcctctcattttccaggtgacc
cccctgagcgggcgccagtgggtggtggtgctccagatatctctgcctgtcatcctgctg
gatgaggccttcaagtacctgtcccggaaccacgtggacggcattctcaggacagtctcg
caggcctggagtaggcagccgatgaccgcctcttggaccccagaccacaccgggttggcc
tcttcggtgtcaccttgtggaaaaaaagagccagaagtgagcgctgggaacggagtggag
tctctgggtgcggctgccgcactatctgcacagctgggggcctctgagcctggtgggctc
tcctggactcttggccacattccttgccccctccgcacgacacccatgagccgaaaggat
gtcactaaggatggctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104682143
Entry
104682143         CDS       T03989                                 

Gene name
ATP2A1
Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform X1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04020  Calcium signaling pathway
rro04022  cGMP-PKG signaling pathway
rro04024  cAMP signaling pathway
rro04260  Cardiac muscle contraction
rro04261  Adrenergic signaling in cardiomyocytes
rro04919  Thyroid hormone signaling pathway
rro04972  Pancreatic secretion
rro05010  Alzheimer disease
rro05017  Spinocerebellar ataxia
rro05022  Pathways of neurodegeneration - multiple diseases
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    104682143 (ATP2A1)
   04024 cAMP signaling pathway
    104682143 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    104682143 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    104682143 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104682143 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    104682143 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    104682143 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    104682143 (ATP2A1)
   05017 Spinocerebellar ataxia
    104682143 (ATP2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    104682143 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104682143 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104682143 (ATP2A1)
   05414 Dilated cardiomyopathy
    104682143 (ATP2A1)
Enzymes [BR:rro01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     104682143 (ATP2A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 104682143
NCBI-ProteinID: XP_010386955
UniProt: A0A2K6NHN5
LinkDB
Position
20
AA seq 1001 aa
MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGPNELPAEEGKTLWELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKAVQRIKARDIVPGDIVEVAVGDKVPADIRILAIKSTTLRVDQSIL
TGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVSTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWIRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVDGDICLLNEFSITGSTYAPEGEVLKNDKPVRPGQYDGLVELATICALC
NDSSLDFNEAKGVYEKVGEATETALTTLVEKMNVFNTDVRNLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGP
VKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMILDDSARFLEYETDLTFVGVVGML
DPPRKEVMGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDD
LPLPEQREACRRACCFARVEPSHKSKIVEYLQSFDEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKTASEMVLADDNFSTIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAA
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAI
GGYVGAATVGAAAWWFMYAEDGPHVNYSQLTHFMQCTEDNAHFEGIDCEVFEASEPMTMA
LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLVGSICLSMSLHFLILYVDPLPMIFKLQ
ALDLAHWLMVLKISLPVIGLDEILKFIARNYLEDPEDERRK
NT seq 3006 nt   +upstreamnt  +downstreamnt
atggaggccgctcacgctaaaaccacggaggaatgtttggcctattttggggtgagtgag
accacgggcctcaccccggaccaagttaagcggaatctggagaaatacggccccaatgag
ctccctgctgaggaagggaagaccctgtgggagctggtgatagagcagtttgaagacctc
ctggtgcggatcctcctcctggccgcatgcatttccttcgtgctggcctggtttgaggaa
ggtgaagagaccatcactgcctttgttgaaccttttgtcatcctcttgatcctcattgcc
aatgccatcgtgggggtgtggcaggagcggaacgcagagaatgccatcgaggccctgaag
gagtatgagccagagatggggaaggtctaccgggctgaccgcaaggcagtgcaaaggatc
aaggctcgggacatcgtccccggggacatcgtggaggtggctgtgggagacaaagtccct
gcagacatccgaatcctcgccatcaaatccaccaccctgcgggttgaccagtccatcctg
acaggcgagtctgtatctgtcatcaagcacacggagcccgttcctgacccccgagctgtc
aaccaggacaagaagaacatgcttttctcgggcaccaacattgcagctggcaaggccttg
ggcattgtggccaccaccggtgtgagcactgagattgggaaaatccgagaccaaatggct
gccacagaacaggacaagacccctttgcagcagaagctggatgagtttggggagcagctc
tccaaggtcatctccctcatctgtgtggctgtctggctcatcaacattggccacttcaac
gaccctgtccatgggggctcctggatccgcggggccatctactactttaagattgccgtg
gccttggctgtggctgccatccccgaaggtcttcctgcagtcatcaccacctgcctggcc
ctgggtacccgccggatggcaaagaagaatgccattgtaaggagcttgccctccgtagag
accctgggctgcacctctgtcatctgttccgacaagacaggcaccctcaccaccaaccag
atgtctgtctgcaagatgtttatcattgataaggtggatggggacatctgcctcctgaat
gagttctccatcactggctccacttacgctccagagggagaggtcttgaagaatgataag
ccagtccggccagggcagtatgacgggctggtggagctggccaccatctgtgccctctgc
aatgactcctccttggacttcaacgaggccaaaggtgtctatgagaaggttggcgaggcc
accgagacagcactcaccaccctggtggagaagatgaatgtattcaacacagatgtgaga
aacctctcgaaggtggagagagccaacgcctgcaactcggtgatccgccagctaatgaag
aaggaattcaccctggagttctcccgtgacaggaagtccatgtctgtctattgctcccca
gccaaatcttcccgggctgctgtgggcaacaagatgtttgtcaagggtgcccccgagggc
gtcatcgaccgctgtaactatgtgcgagttggcaccacccgggtgccactgacggggcca
gtgaaggagaagatcatggcagtgatcaaggagtggggcactggccgggacactctgcgc
tgcttggccctggccacaagggacacccccccgaagcgagaggaaatgatcctggatgac
tctgccaggttcctagaatatgagacggacctgacattcgtgggcgtggtgggcatgctg
gaccctccacgcaaggaggtcatgggctccatccagctgtgccgtgacgctgggatccgg
gtgatcatgatcactggggacaacaagggcacagccattgccatctgccggcgaattggc
atctttggggagaacgaggaggtggccgatcgcgcctacacgggccgagagttcgatgac
ctgcctctgcctgaacagcgggaagcctgccgacgtgcctgctgcttcgcccgcgtggag
ccctcacacaagtccaagattgtggagtacctgcagtccttcgatgagatcacagccatg
acaggtgatggcgtcaatgacgcccctgccctgaagaaggccgagattggcattgccatg
ggatctggcactgctgtggccaagactgcctctgagatggtgctggctgacgacaacttc
tccaccatcgtagctgctgtggaggagggccgcgccatctataacaacatgaagcagttc
atccgctacctcatttcctccaacgtgggcgaggtggtctgcatcttcctgactgctgcc
ctggggctgcccgaggccctgatcccggtgcagctgctgtgggtgaacttggtgaccgac
gggctcccagccacagccctgggcttcaacccaccagacctggacatcatggaccgcccc
ccccggagccccaaggagcctctcatcagtggctggctcttcttccgctacatggcaatc
gggggctatgtgggtgcagccaccgtgggagcggctgcctggtggttcatgtacgctgag
gacgggcctcatgtcaactacagccagctgactcacttcatgcagtgcaccgaggacaac
gcccacttcgagggcatagactgtgaggtcttcgaggcctctgagcccatgaccatggcc
ttgtccgtgctggtgaccatcgagatgtgcaacgcactcaacagcctgtccgagaaccag
tccctgctgcggatgccaccctgggtgaacatctggctggtgggctccatctgcctctcc
atgtccctgcacttcctcatcctctacgttgaccccctgccgatgatcttcaagctccag
gccctggacctcgcccactggctcatggtcctcaagatctcactgccggtcattgggctc
gacgaaatcctcaagttcattgctcggaactacctagaggatccagaagatgaaagaagg
aagtga

DBGET integrated database retrieval system