KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104674848
Entry
104674848         CDS       T03989                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro01524  Platinum drug resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04530  Tight junction
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05215  Prostate cancer
rro05219  Bladder cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104674848 (ERBB2)
   04012 ErbB signaling pathway
    104674848 (ERBB2)
   04066 HIF-1 signaling pathway
    104674848 (ERBB2)
   04020 Calcium signaling pathway
    104674848 (ERBB2)
   04151 PI3K-Akt signaling pathway
    104674848 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104674848 (ERBB2)
   04520 Adherens junction
    104674848 (ERBB2)
   04530 Tight junction
    104674848 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104674848 (ERBB2)
   05206 MicroRNAs in cancer
    104674848 (ERBB2)
   05205 Proteoglycans in cancer
    104674848 (ERBB2)
   05230 Central carbon metabolism in cancer
    104674848 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    104674848 (ERBB2)
   05226 Gastric cancer
    104674848 (ERBB2)
   05219 Bladder cancer
    104674848 (ERBB2)
   05215 Prostate cancer
    104674848 (ERBB2)
   05213 Endometrial cancer
    104674848 (ERBB2)
   05224 Breast cancer
    104674848 (ERBB2)
   05223 Non-small cell lung cancer
    104674848 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104674848 (ERBB2)
   01524 Platinum drug resistance
    104674848 (ERBB2)
   01522 Endocrine resistance
    104674848 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104674848 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104674848 (ERBB2)
   04090 CD molecules [BR:rro04090]
    104674848 (ERBB2)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104674848 (ERBB2)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   104674848 (ERBB2)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   104674848 (ERBB2)
CD molecules [BR:rro04090]
 Proteins
  104674848 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 104674848
NCBI-ProteinID: XP_010377602
LinkDB
Position
19
AA seq 1255 aa
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTDASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLNNITPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
FTLIDTNRSRACHPCSPVCKGSHCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKSCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDLASNTAPLQPEQLRVFETLEEITGYLYISAWPDSLP
DLSILQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTRLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGVVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGTGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPRAPSEG
TGSDVFDGDLGMGAAKELQSLPAHDPSPLQRYSEDPTVPLPSETDGYVAPLTCSPQPEYV
NQPDVRPQPPSPQEGPLSPARPTGATLERPKTLSPGKNGVVKDVFAFGGTVENPEYLAPR
GGAAPQPHLPPAFSPAFDNLYYWDQDPSEQGAPPSTFKGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcttgccccctggagcc
gcaggcacccaagtgtgcaccggcacagacatgaagctgcggctccctgccagtcccgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggtaacctg
gaactcacctacctgcccaccgatgccagcctctccttcctgcaggatatccaggaggtg
cagggctacgtgctcatcgctcacaaccaagtgaggcaggtcccactgcagaggctgcgg
attgtgcgaggcacccagctctttgaggacaactatgccctggccgtgctagacaatgga
gacccgctgaacaatatcacccctgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaaaggaggggtcttgatccagcggaacccccag
ctctgctaccaggacacgattttatggaaggacatcttccataagaacaaccagctggct
ttcacactgatcgacaccaaccgctctcgggcctgccacccctgttctccggtgtgtaag
ggctcccactgctggggagagagttctgaggattgtcagagcctgacgcgcactgtctgt
gccggtggctgtgcccgctgcaaggggccactgcccactgactgctgccatgagcagtgt
gctgctggctgcacgggccccaagcactctgactgcctggcctgcctccacttcaaccac
agtggcatctgtgaactgcactgcccagccctggtcacctacaacacagacacctttgag
tccatgcccaaccctgagggccggtatacattcggcgccagctgtgtgactgcctgtccc
tacaactacctttctacggacgtgggatcctgcaccctcgtctgccccctgcacaaccaa
gaggtgacagcggaggacggaacacagcggtgtgagaagtgcagcaagtcctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtgagggcggtcaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcttggcatttctgccggagagc
tttgatggcgacctagcctctaacaccgccccgctccagccggagcagctccgagtgttt
gagactctggaagagatcacaggttacctatacatctcagcatggccagacagcctgcct
gaccttagcatcctccagaacctgcaagtaatccggggacgaattctgcacaatggcgcc
tactcactgaccctgcaagggctgggcatcagctggctggggctgcgctcgctgagggaa
ctgggcagtggactggccctcatccaccataacacccgcctctgcttcgtgcacacggta
ccctgggaccagcttttccggaacccgcaccaagccctgctccacactgccaaccggcca
gaggacgagtgtgtgggcgagggcctggcctgccaccagctgtgcgcccgagggcactgc
tggggtccagggcccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggaatgccgagtactgcaggggctccccagggagtatgtgaatgccagacactgt
ttgccatgccaccctgagtgtcagccccagaatggctcagtgacctgttttggaccggag
gctgaccagtgtgtggcctgtgcccactataaggaccctcccttctgcgtggcccgctgc
cccagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacgtgccagccttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctctgacgtccatcatctctgctgtggtgggc
attctactggtcgtggtcttgggggtggtctttggaatcctcatcaagcgacggcagcag
aagatccggaagtacacgatgcggaggctactgcaggaaacggagctggtggagccactg
acaccgagtggagcgatgcccaaccaggcgcagatgcggatcctgaaagagacggagctg
aggaaggtgaaggtgcttggatctggagcttttggcacagtctacaagggcatctggatc
cctgatggggagaatgtgaaaattccagtggccatcaaagtgttgagggaaaatacatcc
cccaaagccaacaaagaaatcttagacgaagcatacgtgatggctggtgtgggctcccca
tatgtctcccgcctcctgggcatctgcctgacatccacagtgcagctggtgacacagctt
atgccctatggctgcctcttagaccatgtccgggaaaaccgcggacgcctgggctcccag
gacctactgaactggtgtatgcagattgccaaggggatgagctacctggaggatgtgcgg
ctcgtacacagggacttggctgctcggaacgtgctggtcaagagtcccaaccatgtcaaa
attacagactttgggctggctcggctgctggacattgatgagacagagtaccatgcagat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgacggcggttcacc
caccagagtgatgtgtggagttatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttatgatgggatcccagcccgggagatccctgacctgctggaaaagggggagcgg
ctgcctcagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgagattccgggagttggtgtctgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagccagtcccttg
gacagcaccttctaccgctcattgctggaggatgatgacatgggggacctggtggatgct
gaggagtatctggtaccccagcagggcttcttctgtccagaccctgcccctggcactggg
ggcatggtccaccacaggcaccgcagctcatctaccaggagtggcggtggggacctgacg
ctagggctggagccctctgaagaggaggcccccaggtctccacgggcaccctccgaaggg
actggctctgatgtatttgatggtgacctgggaatgggggcagccaaggagctgcaaagc
ctccctgcacatgaccccagccctctacagcggtacagtgaggaccccacggtacccctg
ccctctgagactgacggctatgttgcccccctgacctgcagcccccagcccgaatatgtg
aaccagccagatgttcggccacagcccccttcgccccaagagggccctctgtctcctgcc
cgacctactggtgccactctggaaaggcccaagactctctccccagggaagaatggggtt
gtcaaagatgtttttgcctttgggggtactgtggagaaccccgagtacttggcaccccgg
ggaggagctgcccctcagccccaccttcctcctgccttcagcccagccttcgacaacctc
tattactgggaccaggacccatcagagcagggggctccacccagcaccttcaaagggaca
cctacagcagagaacccagagtacctgggtctggacgtgccagtgtga

DBGET integrated database retrieval system