KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675145
Entry
104675145         CDS       T03989                                 

Gene name
SGCG
Definition
(RefSeq) gamma-sarcoglycan isoform X1
  KO
K12564  gamma-sarcoglycan
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro05410  Hypertrophic cardiomyopathy
rro05412  Arrhythmogenic right ventricular cardiomyopathy
rro05414  Dilated cardiomyopathy
rro05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rro00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104675145 (SGCG)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    104675145 (SGCG)
   05414 Dilated cardiomyopathy
    104675145 (SGCG)
   05416 Viral myocarditis
    104675145 (SGCG)
SSDB
Motif
Pfam: Sarcoglycan_1 DUF2345
Other DBs
NCBI-GeneID: 104675145
NCBI-ProteinID: XP_010377909
UniProt: A0A2K6NXY6
LinkDB
Position
18
AA seq 291 aa
MVREQYTTATEGTHIERPENPYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKV
MWFSPAGMGHLRVTEDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEG
EVTGRLKVGPKMVEVQSQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVE
TPLVRADPFQDLRLESPTRSLSMDGPRGVRIQAHAGKIEALSQMDILFHSSDGMLELDAE
TVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVGTTCQEHSHICL
NT seq 876 nt   +upstreamnt  +downstreamnt
atggtgcgtgagcagtacactacagccacagaaggcacccacatagagaggccagagaat
ccgtatgtctacaaaattggcatttatggctggagaaagcgctgcctctacttgtttgtt
cttcttttactcatcatcctcgttgtgaatttagctcttacaatttggattcttaaagtg
atgtggttttctccggcaggaatgggccacttgcgtgtgacagaagatggactgcgcttg
gaaggggaatcagaatttttattcccattgtatgccaaagaaatacactccagagtggac
tcatctctgcttctacagtcaacccagaatgtgactgtaaatgcacgcaactcagaaggg
gaggtcacaggcaggttgaaagtcggtcccaaaatggtagaagtccagagtcaacagttt
cagatcaactccaacgacggcaagccactgtttactgtagatgagaaggaagttgtggtt
ggtacagataaacttcgagtaactggacctgaaggggctcttttcgaacattcagtggag
acaccccttgtcagagccgacccatttcaagaccttagactagaatcccccactcggagt
ctaagcatggatggcccaaggggtgtgcgtattcaagctcacgctgggaaaatcgaggcg
ctttctcaaatggatattctttttcatagtagtgacggaatgctggagcttgatgctgaa
accgtgtgcttacccaaactggtgcaggggacatggggtccctctggcagctcacagagc
ctctacgaaatctgtgtgtgtccagatgggaagctgtacctgtctgtggccggtgtgggc
accacgtgccaggagcacagccacatctgcctctga

DBGET integrated database retrieval system