KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675242Help
Entry
104675242         CDS       T03989                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00052  Galactose metabolism
rro00500  Starch and sucrose metabolism
rro01100  Metabolic pathways
rro04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104675242 (GAA)
   00500 Starch and sucrose metabolism
    104675242 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104675242 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104675242 (GAA)
Enzymes [BR:rro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104675242 (GAA)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104675242 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104675242
NCBI-ProteinID: XP_010378021
UniProt: A0A2K6NW26
LinkDB All DBs
Position
Un
AA seq 952 aa AA seqDB search
MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLVVPRELSGSSSVLEETRPAHQQGA
RRPGPQDAQAHPGCPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLRRA
QMGQSWCFFPPSYPSYKLENLSASEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLH
FTIKDPANRRYEVPLETPRVPSRALSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYIFLGPEPKSVVRQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYVMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGQV
WPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELEK
PPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISR
STFAGHGRYAGHWTGDVWSSWEQLAASVPEILQFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNGLLNLPQEPYSFSEPAQQAMRKALTLRYALLPHLYTLFHQAHVAG
ETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPSGTWYDLETVPI
EALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEAQGELFWDDGESLEVLERGAYTQVLFLARSNTIMNELVRVTSEGAGLQ
LQKVTVLGVATAPQQVLSNGAPVSNFTYSPDTKVLDIPVSLLMGEQFLISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaggcacccgccctgctcccaccggctgctggccgtctgcgccctcgtgtcc
ttggccaccgctgcgctcctggggcacatcctcctccatgatttcctggtggttccccga
gagctgagtggatcctcctcggtcctggaggagactcgcccagctcaccagcagggagcc
aggaggccagggccccaggatgcccaggcacaccccggctgtcccagagcagtgcccaca
cagtgcgacgtccccccgaacagccgcttcgactgtgcccctgacaaggccatcacccag
gaacagtgcgaggcccgcggctgctgctacatccctgcaaagcaggggctgcggagagcc
cagatgggacagtcctggtgcttcttcccacccagctaccccagctacaagctggagaac
ctgagcgcctctgaaatgggctacacggccaccctgacccgtaccacccccaccttcttc
cccaaggacatcctgaccttgcggctggacgtgatgatggagactgagaaccgcctccac
ttcacaatcaaagatcccgctaacaggcgctacgaggtgcccttggagaccccgcgtgtc
cccagccgggcactgtccccactctacagcgtggagttctccgaggagcccttcggggtg
attgtgcgccggcagctggacggccgtgtgctgctgaacacgacggtggcgcccctgttc
tttgcggaccagttccttcagttgtccacctcgctgccctcgcagtacatcacaggactc
gccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaac
cgggacctcgcgcccacgcccggtgcgaacctctacgggtctcaccctttctacctggcg
ctggaggatggcgggtcggcacatggggtgttcctgctgaacagcaatgccatggatgtg
gtcctgcagccgagccctgcccttacctggaggtcgacaggtgggatcctggatgtgtac
atcttcctgggcccggagcccaagagcgtggtgcggcagtacctggatgttgtgggatac
ccgttcatgccgccgtactggggcctgggcttccacctgtgccgctggggctactcctcc
accgccatcacccgccaggtggtagagaacatgaccagggcccacttccccctggacgtc
cagtggaacgacttggactacatggactcccggagggacttcacgttcaacaaggacggc
ttccgggacttcccagccatggtgcaggaactgcaccagggcggccggcgctacgtgatg
attgtggatcctgccatcagcagctcgggccctgccgggagctacagaccgtacgacgag
ggtctgcggaggggggttttcatcaccaacgagaccggccagccgctgattgggcaggtg
tggcctgggtccactgccttccccgacttcaccaaccctgcagccctggcctggtgggag
gacatggtggctgagttccatgaccaggtgccctttgatggcatgtggattgacatgaac
gagccttccaacttcatcaggggctctgaggatggctgccccaacaatgagctggagaag
ccgccctacgtgcctggggtggttggggggaccctccaggcggccaccatctgtgcctcc
agccaccagttcctctccacacactacaacctgcacaacctctacggcctgactgaagcc
atcgcctcccacagggcactggtgaaggctcgggggacacgcccatttgtgatctcccgc
tcgacctttgctggccacggccgatatgccggccactggacgggggacgtgtggagctcc
tgggagcagctcgccgcctccgtgccagaaatcctgcagtttaacctgctgggggtgcct
ctggtcggggccgacgtctgtggcttcctgggcaacacctcagaggagctgtgtgtgcgc
tggacccagctgggggccttttacccctttatgcggaaccacaacggcctgctcaatctg
ccccaggagccatacagtttcagcgagccggcccagcaggccatgaggaaggccctcacc
ctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccacgtcgctggg
gagaccgtggcccggcccctcttcctggagttccccaaggactctagcacctggactgtg
gaccaccagctcctgtggggggaggccctgctcatcaccccagtgctgcaggccgggaag
gccgaagtgaccggctacttcccctcaggcacatggtacgacctggagacggtgccaata
gaggcccttggcagcctcccgcccccacctgcagctccccgtgagccagccatccacagc
gaggggcagtgggtgacgctgccagcccccctggacaccatcaacgtccacctccgggct
gggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgccagcagccc
atggccctggctgtggctctgaccaagggtggggaggcccaaggggagctgttctgggac
gatggagagagcctggaagtgctggagcgaggggcctacacacaggtcctattcctggcc
aggagtaacacgatcatgaatgagctggtacgtgtgaccagcgagggggctggcctgcag
ctgcagaaggtgaccgtcctgggcgtggccacagcgccccagcaggtcctctccaacggt
gcccctgtctccaacttcacctacagccccgacaccaaggtcctggacatccctgtctcg
ctgttgatgggagagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system