KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675473
Entry
104675473         CDS       T03989                                 

Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04614  Renin-angiotensin system
rro04924  Renin secretion
rro05142  Chagas disease
rro05171  Coronavirus disease - COVID-19
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104675473
   04614 Renin-angiotensin system
    104675473
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104675473
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104675473
  09174 Infectious disease: parasitic
   05142 Chagas disease
    104675473
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104675473
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104675473
   04090 CD molecules [BR:rro04090]
    104675473
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     104675473
Peptidases and inhibitors [BR:rro01002]
 Metallo peptidases
  Family M2
   104675473
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104675473
CD molecules [BR:rro04090]
 Proteins
  104675473
SSDB
Motif
Pfam: Peptidase_M2 Peptidase_M32
Other DBs
NCBI-GeneID: 104675473
NCBI-ProteinID: XP_010378369
UniProt: A0A2K6P2X9
LinkDB
Position
19
AA seq 1307 aa
MGAASGRRGPGPLLLLLLLLLPPPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQ
VLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPILQNFTDPELRK
IIGAVGTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASS
RSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFSDTGAYWRSWYNSPTFEDD
LEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVP
FPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVC
HASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEA
IGDVLALSVSTPAHLHKIGLLDRVTNDTEGDINYLLKMALEKIAFLPFGYLVDQWRWGVF
NGRTPPSHYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQ
FHEALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGSDALDAQPL
LNYFQPVTQWLQEQNRQNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEASKFVEEYDRT
SQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARRFDVNHFQNTTIKR
IIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCRTNGSCLQLEPDLTNVMATSRK
YEELLWAWEGWRDKAGRAIVQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLE
RLFQELQPLYLNLHAYVRRALHRHYGAQHVNLEGPIPAHLLGNMWAQTWSNIYDLVVPFP
SAPSMDPTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPADGREVVCHA
SAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIG
DVLALSVSTPKHLHSLNLLSSEGGSHEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDG
SITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFISFIIQFQFH
EALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAILS
YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQ
WLLLFLGIALLVATLGLSQRLFSIRHQSLRQHPQGPQFGSEVELRHS
NT seq 3924 nt   +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccgggggccggggccgctgctgctactgttgctgctgctg
ctgccgccgccgccgcagcccgccctggcgctggaccccgggctgcagcccggcaacttt
tccgccgacgaggccggggcgcagctcttcgcgcagagctacaactcgagcgccgaacag
gtgctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgccgagaac
gcacggcgccaggaggaagcagcgctgctcagccaggagtttgccgaggcctggggccag
aaggcgaaggagctgtatgaaccgatcttgcagaacttcaccgacccggagctgcgcaag
atcatcggagctgtgggcaccctgggctctgccaatctgcccctggctaagcggcagcag
tacaatgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctcccc
aacaagactgccacctgctggtccctggacccagacctcaccaacatcctggcttcctcg
cgaagctacgccatgctcctgtttgcctgggagggctggcacaacgccgcgggcatcccg
ctgaaaccgctgtacgaggacttcactgccctcagcaatgaagcctacaagcaggacggc
ttctcagacacgggggcctactggcgctcctggtacaactcccccacttttgaggacgat
ctggagcacctctatcaacagctagagcccctctacctgaacctccatgcctttgtccgc
cgtgcactgcatcgccgatatggggacagatacatcaacctcaggggacccatccctgct
catctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcct
ttcccagacaagcccaaccttgatgtcaccagtactatgctgcagcagggctggaatgcc
acgcacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcct
cccgagttctgggaagggtcgatgctggagaagccggccgacgggcgggaggtggtgtgc
cacgcctcggcttgggacttctacaacaggaaagacttcaggatcaagcaatgcacacgg
gtcacgatggaccagctctctacagtgcaccacgagatgggccatatacagtactacctg
caatacaaggacctgcccgtctccctgcgcgggggggccaaccccggcttccatgaggcc
attggggacgtgctggcactctcggtctccactcctgcacatctgcacaaaatcggcctg
ctggaccgtgtcaccaatgacacggaaggtgacatcaattacttgctaaagatggcactg
gaaaaaattgccttcctgccctttggctacctggtggaccagtggcgctggggggtcttt
aatgggcgtactcccccttcccactacaacttcgactggtggtatcttcgaaccaagtat
caggggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagttt
catgttccaaatgtgacaccatacatcaggtactttgtgagttttgtcctgcagttccag
ttccatgaagccctgtgcaaggaggcaggctatgagggcccactgcaccaatgtgacatc
taccagtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccagg
ccctggcaggaggtgctgaaggacatggtcggctcagatgccctggacgcccagccactg
ctcaactacttccagccggtcacccagtggctgcaggagcagaaccggcagaacggcgag
gtcctgggctggcctgagtaccagtggcgcccaccgttgcctgacaactacccggagggc
atcgacctggtgaccgatgaggctgaggccagcaagttcgtggaggaatatgaccggaca
tcccaggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacattacc
acagagaccagcaagattctgctgcagaagaacatgcaaatagccaaccatactctgaag
tacggcacccaggccaggaggtttgatgtgaaccacttccagaacaccactatcaagcgg
atcataaagaaggttcaggacctagaacgggcagcgctgcctgcccaggagctggaggag
tataacaagatcctgttggacatggaaaccacctacagcgtggccactgtatgccgcacg
aatggcagctgcctgcagctggagccagatctgacgaatgtgatggccacgtcccggaaa
tatgaagaactgttgtgggcgtgggagggctggcgagacaaggctgggagagccatcgtc
cagttttacccaaaatatgtggaactgatcaaccaggctgcccggctcaatggctatgta
gatgccggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggag
cggctcttccaggagctgcaaccgctgtacctgaacctgcatgcctacgtgcgccgggcc
ctgcaccgccactacggggcccagcacgtcaatctggaggggcccatccctgctcacctg
ctggggaacatgtgggcgcagacctggtccaacatctatgacttggtggtgcccttccct
tcagccccctcgatggaccccacggaggccatgctaaagcagggctggacgccccggagg
atgtttaaggaggctgatgatttcttcacctccctggggctgcttcccgtgcctcctgag
ttctggaacaagtcgatgctggagaagccagccgacgggcgagaggtggtctgccacgcc
tcggcctgggacttctacaacggcaaggacttccggatcaagcagtgcactaccgtgaac
ttggaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtac
aaagacttgcctgtggccttgagggagggtgccaaccccggcttccatgaggccattggg
gacgtgctagccctctcagtgtctacgcccaagcacctgcacagtctgaacctgctgagc
agtgagggtggcagccacgagcacgatatcaactttctgatgaagatggcgcttgacaag
atcgcctttatccccttcagctatcttgttgatcagtggcgctggagggtgtttgacgga
agcatcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggc
ctctgccccccggtgcccaggactcaaggtgactttgacccaggggccaagttccacatt
ccttctagcgtgccttacatcaggtacttcatcagcttcatcatccagttccagttccac
gaagcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccag
tccaaggaggcagggcagcgcctggcgacggccatgaagctgggcttcagtaggccgtgg
ccagaagccatgcagctgatcacgggccagcccaatatgagcgcctcggccatcctgagc
tacttcaagccgctgctggactggctccgcacagagaatgagctgcacggggagaagctg
ggctggccacagtacaactggacaccgaactccgctcgctcagaagggcccctcccagac
agcggccgcgtcagcttcctgggcctggacctggatgcacagcaggcccgcgtgggccag
tggctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcgg
ctcttcagcatccgccaccaaagcctccgccagcacccccaggggccccagttcggctcc
gaggtggagctgagacactcctga

KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675505
Entry
104675505         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme-like protein Ace3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04614  Renin-angiotensin system
rro04924  Renin secretion
rro05142  Chagas disease
rro05171  Coronavirus disease - COVID-19
rro05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    104675505
   04614 Renin-angiotensin system
    104675505
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    104675505
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    104675505
  09174 Infectious disease: parasitic
   05142 Chagas disease
    104675505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rro01002]
    104675505
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104675505
   04090 CD molecules [BR:rro04090]
    104675505
Enzymes [BR:rro01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     104675505
Peptidases and inhibitors [BR:rro01002]
 Metallo peptidases
  Family M2
   104675505
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104675505
CD molecules [BR:rro04090]
 Proteins
  104675505
SSDB
Motif
Pfam: Peptidase_M2 SmpA_OmlA SFXNs
Other DBs
NCBI-GeneID: 104675505
NCBI-ProteinID: XP_010378398
LinkDB
Position
19
AA seq 770 aa
MSFPLGSAIPPHQCCSSLDGCTLTSPVLEERQTHPGLSLLVLLCYRQLLPCLWIKDEHSL
DGFYNETKAKIFLQFYDQTAKVVLNQFMEATWNYVTNITRKNQEEMLHKDMERSQFMIYF
GIRACLFKVAQFQDQDVKRMLRKLQNIDKAALPKDELREYNELLANMEMTYSMTQVCLNE
RPCLSLEPELEEVMATSRNKEEPLWAWQGWRDAVGRQICTTFEHYVELSNKAAQLNGYKD
MGALWRSKYESDTLKQDLERFFQELRPLYLNLHTYMHRALHRHYGPELINLRGPIPAHLR
GNMWAQSSVNVLDLVLPFPKKIPEDVTKIMKGQHWKSEKMFEDSEKFFTSLGLLPAPPSF
WKKSMLTRPTDGREVECHTSAWNFYLDDDFRIKKCTEVTIEDLLSIFHEMSHIQYFLQYK
NLSIIFCEGANPAFEEAVGSVITLSASSHKHLLNIGLLSLKHQDSEDEVNFLMRIALEKI
AFIPFGXLLDLFHXKVFDGTIRKDIYSQEWWNLRLKYQGLCPPVPHSEEDFDPGAKFHIS
AGVPYIXYFFSLVLQFQFHETLCKASGHMGPLHQCDIYNSKIAGKLLGDALKLGSSKPWP
EVLKMLTGESEVCIKALMTYFIPILNWLVTDNMQQGDILGWPDFSCSFEEKDTDKVTFLN
LKLDPNQAKFGYWVLLALGFVMSLVVLGLACRLHSLEKQSLTQDTEIFSPLPNAYFLGIA
MEPHQTAKRQWMLLSLCLVLMLCSINLAIWIFTQXSRTPPWVRAEWWSWD
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgtcatttccattgggatcagctatccccccacaccagtgctgcagctctctggatgga
tgcaccctgacctcccctgtgttggaggagagacagactcaccctggactttccctactt
gtgctcctctgttacaggcagctgttgccttgcctctggatcaaggatgaacatagttta
gatggcttctacaatgagactaaggccaagatcttcttgcagttttatgaccaaacagct
aaagttgtgttgaaccagttcatggaggccacttggaactatgtcaccaacatcaccagg
aaaaatcaggaggagatgctgcacaaggacatggagaggtcccagttcatgatttacttt
ggcatccgggcctgcctgtttaaggtcgcccagttccaggaccaggatgtgaagcgcatg
ctgagaaagctgcagaacatagacaaggcggccctgcccaaggacgagctgcgggagtat
aacgagcttctggccaacatggagatgacatacagtatgacccaggtgtgcctgaatgag
aggccctgcctgtccctggagcctgaactcgaagaagtcatggccacctccaggaacaaa
gaggagccgctgtgggcctggcaaggctggcgggatgccgtgggccgccagatctgcacc
accttcgagcactatgtggagctcagcaacaaggctgcacagctcaatggttacaaagac
atgggagccttgtggcgctccaagtatgagtcagacaccctgaagcaagacctggagcgg
ttcttccaggagctgcggccactctacctgaacctgcacacctacatgcaccgggccctc
caccgccactatgggcccgagctcatcaacctgagggggcccatccctgcccacctccgg
gggaacatgtgggctcagtcctcggtcaacgtcttagacctggtcctgcccttcccaaag
aagattcctgaggatgtcacaaagatcatgaaaggccagcactggaaatcagagaaaatg
tttgaagactctgagaaattcttcacctccttggggctgctgcctgccccacccagtttc
tggaaaaagtcgatgctgacgaggccaaccgatgggcgagaggtggagtgtcacacctct
gcctggaacttctaccttgacgatgacttcagaataaagaagtgcacggaggtgaccata
gaagacctgctctccatcttccacgagatgagccatatccagtactttctgcagtacaag
aacctttccatcatcttctgtgaaggtgccaacccagcctttgaagaggctgtggggtct
gtgatcaccctctcggcctcctcccacaagcacctgctcaacataggcctgctcagcctc
aagcaccaggactcagaggatgaggtcaatttcctgatgcgaattgccctggagaagatt
gccttcatccccttcggctaactgttggacctgtttcactagaaggtctttgacggcacc
attcggaaagacatctacagtcaggagtggtggaacctcaggttaaaataccagggcttg
tgcccccctgttcctcactcagaggaagactttgatccaggtgccaagttccacatttct
gctggtgtgccctacatatgatacttcttcagtctggtgctccagttccagttccatgaa
acactgtgcaaagcctcgggccacatgggtccactgcaccagtgtgacatctacaactcc
aagattgccgggaagctcctgggagatgctctaaagctgggctcaagcaagccgtggcca
gaggtcctaaagatgctgactggggagtctgaggtgtgtataaaggccctcatgacctac
ttcatacccatactgaactggctggtaactgacaacatgcagcaaggggacatcctaggc
tggccagacttcagctgttcctttgaagaaaaagacacagacaaagtgacattcctgaat
ctgaagctggaccccaaccaggctaaatttgggtactgggtgctgctggccctgggcttt
gtcatgtctctggtggtgctggggctggcctgcaggctgcactccctggaaaaacagtca
ctgacccaagacactgagatattcagcccactgcccaatgcctacttcctgggcatagcc
atggaaccccaccagactgctaaaagacagtggatgctgctgagcctctgccttgtcctg
atgctgtgctcaatcaacctggccatctggattttcacacagtaaagcaggacgcctcca
tgggtaagagctgaatggtggagctgggactag

DBGET integrated database retrieval system