KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104675886
Entry
104675886         CDS       T03989                                 

Gene name
EGFR
Definition
(RefSeq) LOW QUALITY PROTEIN: epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro01521  EGFR tyrosine kinase inhibitor resistance
rro01522  Endocrine resistance
rro04010  MAPK signaling pathway
rro04012  ErbB signaling pathway
rro04014  Ras signaling pathway
rro04015  Rap1 signaling pathway
rro04020  Calcium signaling pathway
rro04066  HIF-1 signaling pathway
rro04068  FoxO signaling pathway
rro04072  Phospholipase D signaling pathway
rro04144  Endocytosis
rro04151  PI3K-Akt signaling pathway
rro04510  Focal adhesion
rro04520  Adherens junction
rro04540  Gap junction
rro04630  JAK-STAT signaling pathway
rro04810  Regulation of actin cytoskeleton
rro04912  GnRH signaling pathway
rro04915  Estrogen signaling pathway
rro04921  Oxytocin signaling pathway
rro04926  Relaxin signaling pathway
rro04928  Parathyroid hormone synthesis, secretion and action
rro04934  Cushing syndrome
rro05160  Hepatitis C
rro05163  Human cytomegalovirus infection
rro05165  Human papillomavirus infection
rro05171  Coronavirus disease - COVID-19
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05206  MicroRNAs in cancer
rro05210  Colorectal cancer
rro05212  Pancreatic cancer
rro05213  Endometrial cancer
rro05214  Glioma
rro05215  Prostate cancer
rro05218  Melanoma
rro05219  Bladder cancer
rro05223  Non-small cell lung cancer
rro05224  Breast cancer
rro05225  Hepatocellular carcinoma
rro05226  Gastric cancer
rro05230  Central carbon metabolism in cancer
rro05231  Choline metabolism in cancer
rro05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104675886 (EGFR)
   04012 ErbB signaling pathway
    104675886 (EGFR)
   04014 Ras signaling pathway
    104675886 (EGFR)
   04015 Rap1 signaling pathway
    104675886 (EGFR)
   04630 JAK-STAT signaling pathway
    104675886 (EGFR)
   04066 HIF-1 signaling pathway
    104675886 (EGFR)
   04068 FoxO signaling pathway
    104675886 (EGFR)
   04020 Calcium signaling pathway
    104675886 (EGFR)
   04072 Phospholipase D signaling pathway
    104675886 (EGFR)
   04151 PI3K-Akt signaling pathway
    104675886 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104675886 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104675886 (EGFR)
   04520 Adherens junction
    104675886 (EGFR)
   04540 Gap junction
    104675886 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104675886 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104675886 (EGFR)
   04915 Estrogen signaling pathway
    104675886 (EGFR)
   04921 Oxytocin signaling pathway
    104675886 (EGFR)
   04926 Relaxin signaling pathway
    104675886 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    104675886 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104675886 (EGFR)
   05206 MicroRNAs in cancer
    104675886 (EGFR)
   05205 Proteoglycans in cancer
    104675886 (EGFR)
   05230 Central carbon metabolism in cancer
    104675886 (EGFR)
   05231 Choline metabolism in cancer
    104675886 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    104675886 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    104675886 (EGFR)
   05212 Pancreatic cancer
    104675886 (EGFR)
   05225 Hepatocellular carcinoma
    104675886 (EGFR)
   05226 Gastric cancer
    104675886 (EGFR)
   05214 Glioma
    104675886 (EGFR)
   05218 Melanoma
    104675886 (EGFR)
   05219 Bladder cancer
    104675886 (EGFR)
   05215 Prostate cancer
    104675886 (EGFR)
   05213 Endometrial cancer
    104675886 (EGFR)
   05224 Breast cancer
    104675886 (EGFR)
   05223 Non-small cell lung cancer
    104675886 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    104675886 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    104675886 (EGFR)
   05171 Coronavirus disease - COVID-19
    104675886 (EGFR)
   05163 Human cytomegalovirus infection
    104675886 (EGFR)
   05165 Human papillomavirus infection
    104675886 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    104675886 (EGFR)
   01522 Endocrine resistance
    104675886 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rro01001]
    104675886 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rro04147]
    104675886 (EGFR)
Enzymes [BR:rro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104675886 (EGFR)
Protein kinases [BR:rro01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   104675886 (EGFR)
Exosome [BR:rro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   104675886 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   104675886 (EGFR)
  Exosomal proteins of bladder cancer cells
   104675886 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 104675886
NCBI-ProteinID: XP_010378850
UniProt: A0A2K6R6K2
LinkDB
Position
6
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSNFLSNMSMDF
QNHLGSCQKCDPGCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGSGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggccgcgctcctggcgctgctggctgcgctctgcccc
gcgagtcgggctctggaggaaaagaaagtttgccaaggcactagtaacaaactcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctatgtgcagaggaattacgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacactgtggagcggattcct
ttggaaaacctgcagatcatcagaggaaacatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcaactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaggctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgtggcaagtcccccagtgattgctgccacaaccagtgtgccgcgggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacgtaccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgtggggcggacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggaccttcatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattgcgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccagaatgtcagccgaggcagagaatgcgtggacaagtgcaac
atcctggagggtgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacgggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccagcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctatggatgcactgggtcaggtcttgaaggctgtgcaaggaacggg
cctaagatcccgtccatcgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcgg
aggctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaagaagatcaaagtgctgggctcc
ggtgcgttcggaactgtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacatctccaaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagcttatcacgcagctcatgcccttcggctgcctcctggac
tacgtccgggaacacaaggacaatatcggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacttggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacgccacagcatgtcaagatcacagattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtt
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgacgtggtagatgccgacgagtacctcatcccacag
cagggcttcttcagcagcccctccacatcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cccgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccctgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacagccctgctcattgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

DBGET integrated database retrieval system