KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677104
Entry
104677104         CDS       T03989                                 

Gene name
IGF2
Definition
(RefSeq) insulin-like growth factor II isoform X1
  KO
K13769  insulin-like growth factor 2
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04010  MAPK signaling pathway
rro04014  Ras signaling pathway
rro04151  PI3K-Akt signaling pathway
rro05200  Pathways in cancer
rro05205  Proteoglycans in cancer
rro05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:rro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104677104 (IGF2)
   04014 Ras signaling pathway
    104677104 (IGF2)
   04151 PI3K-Akt signaling pathway
    104677104 (IGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    104677104 (IGF2)
   05205 Proteoglycans in cancer
    104677104 (IGF2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    104677104 (IGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rro04052]
    104677104 (IGF2)
   00536 Glycosaminoglycan binding proteins [BR:rro00536]
    104677104 (IGF2)
Cytokines and growth factors [BR:rro04052]
 Growth factors
  Growth factors (RTK binding)
   104677104 (IGF2)
Glycosaminoglycan binding proteins [BR:rro00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   104677104 (IGF2)
SSDB
Motif
Pfam: IGF2_C Insulin
Other DBs
NCBI-GeneID: 104677104
NCBI-ProteinID: XP_030773784
LinkDB
Position
15
AA seq 180 aa
MGIPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVS
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWK
QSTQRLRRGLPALLRARRGRVLAKELEAFREAKRHRPLIALPTQDPTHGGASPEMSSNRK
NT seq 543 nt   +upstreamnt  +downstreamnt
atgggaatcccaatggggaagtcgatgctggtgcttctcaccttcttggccttcgcctcg
tgctgcattgctgcttaccgccccagtgagaccctgtgtggcggggagctcgtggacacc
ctccagttcgtctgtggggaccgcggcttctacttcagcaggcccgcaagccgtgtgagc
cgtcgcagccgtggcatcgttgaggagtgctgtttccgcagctgtgacctggccctcctg
gagacgtactgtgctacccccgccaagtccgagagggacgtgtcgacccctccgaccgtg
cttccggacaacttccccagataccccgtgggcaagttcttccaatatgacacctggaag
cagtccacccagcgtctgcgcaggggcctgcctgccctcctgcgtgcccgccggggtcgc
gtgctcgccaaggagctcgaggcattcagggaggccaagcgtcaccgtcccctgattgct
ctgcccacccaagaccccacccacgggggcgcgtccccagagatgtccagcaatcggaag
tga

DBGET integrated database retrieval system