KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104677107
Entry
104677107         CDS       T03989                                 

Gene name
TRPM5
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 5 isoform X1
  KO
K04980  transient receptor potential cation channel subfamily M member 5
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rro00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    104677107 (TRPM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rro04040]
    104677107 (TRPM5)
Ion channels [BR:rro04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   104677107 (TRPM5)
SSDB
Motif
Pfam: LSDAT_euk LSDAT_prok Ion_trans
Other DBs
NCBI-GeneID: 104677107
NCBI-ProteinID: XP_010380368
LinkDB
Position
15
AA seq 1163 aa
MQDVQGPCPGSPEDAEDQQGLGLRRGEVDFGGSGKKRGKFVRVLSGVAPSVLFDLLLAEW
HLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKVAQSTGAWILTSALHVGLARHVGQAV
RDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDIPVHYPEDDGSSQGPLCSLDSNL
SHFILVEPGPLGKDDGLMELRLRLEKHISEQRTGYGGTGSIEIPVLCLLVNGDPSTLERI
SRAVEQAAPWLILAGSGGIADVLAALVNQPHLLVPRVAEKQFKEKFPSEHFSWEDIVRWT
KLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLDELKLAVAWDH
VDIAKSEIFNGDVEWKSCDLEEVMVDALVSNKPEFVRLFVDNGADVADFLTYGRLQQLYR
SVSPKSLLFDLLQRKQEEARLTLAGLGAQQAREPPMGPPAFSLHEVSRVLKDFLQDACRG
FYQDGRPGGRRKAEKGPAKQPTGQKWLLDLNQKSENPWRDLFLWAVLQNRHEMATYFWAM
GQEGVAAALAACKILKEMSHLETEAEAARAMREAKYEQLALDLFSECYSNSEDLAFALLV
RRNRCWSKTTCLHLATEADAKAFFAHDGVQAFLTRIWWGDMAAGTPILRLLGAFFCPALV
YTNLITFSEEASLRTGLEDLQELDSLDMEKSLLHSRVEEMVQAPRAQGDRGPRAVFLLTR
WRKFWGAPVTVFLGNVVMYFAFLFLFTYVLLLDFRPPPQGPSGPEVTLYFWVFTLVLEEI
RQGFFTDEDTHLLKKFTLYVGDNWNKCDMVAIFLFIVGVTCRMLPLAFEAGRTVLAMDFM
VFTLRLIHIFAIHKQLGPKIIVVERMMKDVFFFLFFLSVWLVAYGVTTQALLHPHDGRLE
WIFRRVLYRPYLQIFGQIPLDEIDEARVNCSTHPLLLEDSPSCPSLYANWLVILLLVTFL
LVTNVLLMNLLIAMFSYTFQVVQGNADMFWKFQRYNLIVEYHERPALAPPFILLSHLSLA
LRRVFKKEAEHKREHLERDLPDPLDQKVVTWETVQKENFLSKMEKRKRDSEGEVLRKTAN
RVDFVAKYLGGLREQEKRIKHLESQINYCSVLVSSVADMLAQGGSPWTGSRHCGGGSRLV
ASYHRGGLHGQEPPGAGQPSSDT
NT seq 3492 nt   +upstreamnt  +downstreamnt
atgcaggatgtccaaggcccctgtcccggaagccccgaggatgctgaagaccagcagggg
ctaggcttgcgcaggggcgaggtcgactttggagggtctgggaagaaacgaggcaagttt
gtacgggtgctgagcggagtggccccgtctgtgctctttgacctgctgcttgctgagtgg
cacctgccggcccccaacctggtggtgtcccttgtgggtgaggagcagcctttcgccatg
aagtcctggctgcgggacgtactgcgcaaggggctggtgaaggtggctcagagcacagga
gcctggatcctgaccagtgccctccacgtgggcctggcccggcatgtcgggcaggccgtg
cgcgaccactcgctggccagcacatccaccaaggtccgtgtggttgccgtcggcatggcc
tctctgggccgcgtcctgcaccgccgcattctggaggaggcccaggaggatattcctgtc
cactaccccgaggatgacggcagcagccaggggcctctctgttcgctggacagcaacctc
tcccacttcatcctggtggagccaggccccttggggaaggacgatgggctgatggagctg
cggctcaggctggagaagcacatctcggagcagaggacaggctacgggggcactggcagc
atcgagatccctgtcctctgcttgctggtcaatggtgatcccagcaccttggagaggatc
tccagggccgtggagcaggctgccccgtggctgatcctggcaggctcggggggcatcgcc
gatgtgctcgctgccctggtgaaccagccccacctcctggtgcccagggtggctgagaag
cagtttaaggagaagttccccagcgagcatttctcttgggaggacattgtgcgctggacc
aagctgctgcagaacatcacctcacaccagcacctgctcaccgtgtacgactttgagcag
gagggctccgaggagctggacacagtcatcctgaaggcgctggtgaaagcctgcaagagc
cacagccaggagcctcaggactatctggatgagctcaagctggccgtggcctgggaccac
gtggacatcgccaagagtgagatcttcaatggggacgtggagtggaagtcctgtgacctg
gaggaggtgatggtggacgccctggtcagcaacaagcctgagtttgtgcgcctgtttgtg
gacaacggcgcggacgtggctgacttcctgacgtatgggcggctgcagcagctttaccgc
tccgtgtcgcccaagagcctgctcttcgacctgctgcagcggaagcaggaggaggcgcgg
ctgacgctggccggcctgggtgcccagcaggcccgggagccacccatggggccacccgcc
ttctcccttcacgaggtctcccgtgtactcaaggacttcctgcaggacgcctgccgagga
ttctaccaggacggccggccggggggccgcaggaaggcggagaagggcccagccaagcag
cccacaggccagaagtggctgctggacctgaaccagaagagtgagaacccctggcgggac
ctcttcctgtgggccgtgctgcagaaccgccacgagatggccacctacttctgggccatg
ggccaggaaggtgtggcagccgctctggccgcctgcaaaatcctcaaagagatgtcgcac
ctggagacggaggccgaggcggcccgagccatgcgcgaggcaaagtacgagcagctggcc
ctggacctcttttctgagtgctacagcaacagtgaggacctcgccttcgccctgctggtg
cgccggaaccgctgctggagcaagaccacctgcctgcacctggccaccgaggctgatgcc
aaggccttctttgcccacgatggcgtgcaggccttcctgaccaggatctggtggggggac
atggctgcgggcacgcctattctgcggctgctaggagccttcttctgccccgccctcgtc
tataccaacctcatcaccttcagtgaggaagcctccctgaggacaggcctggaggacctg
caggagctggacagcctggacatggagaagagtctgctgcacagccgggtggaggagatg
gtgcaggcgccgagggctcagggtgaccgaggcccgcgtgctgtcttcctgctcacacgc
tggcggaagttctggggcgctcccgtgactgtgttcctggggaatgtggtcatgtacttc
gccttcctcttcctgttcacctacgtcctgctgttggacttcaggccgcccccccaggga
ccctcagggcccgaggtcactctctacttctgggtctttacactggtgctggaggaaatc
cggcagggtttcttcacagatgaggacacacacctgctgaagaagttcacactgtatgtg
ggggacaactggaacaagtgtgacatggtggccatcttcctgttcatcgtgggtgtcacc
tgcaggatgctgcccttggcgtttgaggctggccgcacagtcctcgccatggacttcatg
gtgttcacgctgcggctgatccacatctttgccatacacaagcagctgggccccaagatc
atcgtggtggagcgcatgatgaaggacgtcttcttcttcctcttctttctgagcgtgtgg
ctcgtggcctacggcgtcaccacccaggcgctgctgcacccccatgacggccgcctggag
tggatcttccgccgggtgctctaccggccctacctgcagatcttcgggcagatcccactg
gacgagattgatgaagcccgtgtgaactgctccacccacccactgctgctagaggactca
ccatcctgccccagcctctacgccaactggctggtcatcctcctgctggtcaccttcctg
ttggtcaccaacgtgctgctcatgaacctgcttatcgccatgttcagctacaccttccag
gtggtgcagggcaacgcagacatgttctggaagttccagcgctacaacctgattgtggag
taccacgagcgccccgccctggccccgcccttcatcctgctcagccacctgagcctggca
ctccgcagggtcttcaagaaggaggccgagcacaagcgggagcacctggagagagacctg
ccagaccccctggaccagaaggtcgtcacttgggagacagtgcagaaggagaacttcctg
agcaagatggagaagcggaagagggacagcgagggggaggtgctgcggaaaaccgccaac
agagtggacttcgttgccaagtacctcggggggctgagggagcaagaaaaacgcatcaag
catctggagtcacagatcaactattgctcggtgctcgtgtcctctgtggctgacatgctg
gcccagggtggcagcccctggacaggctctcgacactgtggcgggggaagccggctggtg
gcctcttaccatagagggggtttacatggccaggaaccacccggggctggccagccttcc
tcggacacctaa

DBGET integrated database retrieval system